Protein Info for SMc01438 in Sinorhizobium meliloti 1021

Annotation: protease precursor signal peptide protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 503 signal peptide" amino acids 1 to 28 (28 residues), see Phobius details TIGR02037: peptidase Do" amino acids 40 to 494 (455 residues), 472 bits, see alignment E=9.7e-146 PF00089: Trypsin" amino acids 103 to 259 (157 residues), 68.6 bits, see alignment E=1.8e-22 PF13365: Trypsin_2" amino acids 104 to 238 (135 residues), 128.6 bits, see alignment E=8.3e-41 PF00595: PDZ" amino acids 273 to 339 (67 residues), 31.3 bits, see alignment E=5.6e-11 amino acids 408 to 464 (57 residues), 23.9 bits, see alignment 1.1e-08 PF13180: PDZ_2" amino acids 278 to 368 (91 residues), 48.6 bits, see alignment E=2.1e-16

Best Hits

KEGG orthology group: None (inferred from 100% identity to smk:Sinme_2099)

Predicted SEED Role

"HtrA protease/chaperone protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q926C8 at UniProt or InterPro

Protein Sequence (503 amino acids)

>SMc01438 protease precursor signal peptide protein (Sinorhizobium meliloti 1021)
MSKRPEFFRGLVLAAATALIFTNATLAQTATSRPPAGPPSVADLAEGLLDAVVNISISQN
VKSDDDNAPMPQVPEGSPHQEFFDEFFRGQGGEGGRPRTVNSLGSGFIIDPAGYIVTNNH
VIQDADDIEINFSDGSKLKAKLVGMDTKTDLALLKVEPKKPLKAVSFGDSRKIRIGDWVM
VVGNPFGLGVSVSVGVVSARGRNINAGPYDSFIQTDAAINRGNSGGPLFNMQGEVVGINT
AILSQTGMSVGIGFAVPAELAVNVVNQLKEFGETRRGWLGVRIQPVTDDIAESLKMELPR
GALVSGIIEGGPITKGEIKPGDIIIRFDGTDIAEIRDLMRTVGESPVGKAVDVVIIRDGK
EQTVRVTLGRLEDGEQLANAKPGEVLPNGGEAKPGEPPAAQLPASDTVLGMKLAELDADS
RQSFGIAESVKGVVITEVQPNSPAAERRVEPGEVIVELGQEAMETPEDVTSRVTELKADG
RRNALLMIANKSGELRFVTVRME