Protein Info for SMc01430 in Sinorhizobium meliloti 1021

Annotation: acetolactate synthase 3 regulatory subunit

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR00119: acetolactate synthase, small subunit
  • amino acids 23 to 187 (165 residues), 174.6 bits, E=7.4e-56
• PF01842: ACT
  • amino acids 24 to 89 (66 residues), 52.3 bits, E=5.7e-18
• PF13710: ACT_5
  • amino acids 32 to 95 (64 residues), 49 bits, E=6.4e-17
• PF10369: ALS_ss_C
  • amino acids 113 to 186 (74 residues), 89.6 bits, E=1.8e-29

Best Hits

Swiss-Prot: 47% identical to ILVH_ARCFU: Probable acetolactate synthase small subunit (ilvH) from Archaeoglobus fulgidus (strain ATCC 49558 / VC-16 / DSM 4304 / JCM 9628 / NBRC 100126)

KEGG orthology group: K01653, acetolactate synthase I/III small subunit [EC: 2.2.1.6] (inferred from 98% identity to rhi:NGR_c20160)

MetaCyc: 47% identical to acetohydroxyacid synthase subunit H (Cupriavidus necator H16)
Acetolactate synthase. [EC: 2.2.1.6]; 2.2.1.6 [EC: 2.2.1.6]

Predicted SEED Role

"Acetolactate synthase small subunit (EC 2.2.1.6)" in subsystem Acetoin, butanediol metabolism or Branched-Chain Amino Acid Biosynthesis (EC 2.2.1.6)

MetaCyc Pathways

• superpathway of branched chain amino acid biosynthesis (17/17 steps found)
• superpathway of L-isoleucine biosynthesis I (13/13 steps found)
• L-isoleucine biosynthesis I (from threonine) (7/7 steps found)
• L-valine biosynthesis (4/4 steps found)
• superpathway of L-threonine metabolism (14/18 steps found)
• pyruvate fermentation to (R)-acetoin I (3/3 steps found)
• pyruvate fermentation to (S)-acetoin (3/3 steps found)
• superpathway of 2,3-butanediol biosynthesis (5/6 steps found)
• pyruvate fermentation to isobutanol (engineered) (4/5 steps found)
• superpathway of (R,R)-butanediol biosynthesis (4/5 steps found)
• L-isoleucine biosynthesis IV (4/6 steps found)
• pyruvate fermentation to (R)-acetoin II (1/2 steps found)
• L-isoleucine biosynthesis II (5/8 steps found)
• L-isoleucine biosynthesis III (4/7 steps found)

KEGG Metabolic Maps

• Biosynthesis of alkaloids derived from histidine and purine
• Butanoate metabolism
• C5-Branched dibasic acid metabolism
• Pantothenate and CoA biosynthesis
• Valine, leucine and isoleucine biosynthesis

Isozymes

Compare fitness of predicted isozymes for: 2.2.1.6

Use Curated BLAST to search for 2.2.1.6

Sequence Analysis Tools

See Q92NR6 at UniProt or InterPro

Protein Sequence (190 amino acids)

>SMc01430 acetolactate synthase 3 regulatory subunit (Sinorhizobium meliloti 1021)
MNAHLQPTGSAYFIAKETELAETHTLSVLVDNEPGVLARVIGLFSGRGYNIESLTVSETE
HEAHLSRITIVTRGTPHVLEQIKNQLERLVPVHRVVDLTVRAAGLGHERPIERELALVKV
HGSGEHRVEALRLADAFRASVIDANIDHFVFEITGKPSKIEQFIAIMKPLGLIEVCRTGI
AAMNRGPQGM