Protein Info for SMc01419 in Sinorhizobium meliloti 1021

Annotation: RNA polymerase sigma factor protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 184 TIGR02937: RNA polymerase sigma factor, sigma-70 family" amino acids 20 to 172 (153 residues), 75.1 bits, see alignment E=2.4e-25 PF04542: Sigma70_r2" amino acids 28 to 90 (63 residues), 39.4 bits, see alignment E=6.3e-14 PF08281: Sigma70_r4_2" amino acids 115 to 168 (54 residues), 53.2 bits, see alignment E=2.8e-18 PF04545: Sigma70_r4" amino acids 122 to 168 (47 residues), 34.7 bits, see alignment E=1.6e-12

Best Hits

Swiss-Prot: 33% identical to SIGR_STRCO: ECF RNA polymerase sigma factor SigR (sigR) from Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145)

KEGG orthology group: K03088, RNA polymerase sigma-70 factor, ECF subfamily (inferred from 100% identity to sme:SMc01419)

Predicted SEED Role

"macromolecule metabolism; macromolecule synthesis, modification; rna synthesis, modification , dna transcription"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q92NS5 at UniProt or InterPro

Protein Sequence (184 amino acids)

>SMc01419 RNA polymerase sigma factor protein (Sinorhizobium meliloti 1021)
MSHGPDGPETGARADPAAPDAFEEEVLELMPALRRYSRSLAHSDPDGEDLLQDCVEKVLA
RREQWRGVNLRAWAFTIMTNLFRNGHRRRAQHPEVEFDEALGLRAEEDNADPLERQRLMR
GLERLSADNRAVLMLVVIEGYRYQDVADMMEIPIGTVMSRLSRARRQLAEAMKDDNVIAL
RRPK