Protein Info for SMc01406 in Sinorhizobium meliloti 1021

Annotation: transcriptional regulator

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 472 PF00392: GntR" amino acids 21 to 84 (64 residues), 53.4 bits, see alignment E=1.7e-18 PF00155: Aminotran_1_2" amino acids 141 to 457 (317 residues), 80.5 bits, see alignment E=1.4e-26

Best Hits

Swiss-Prot: 48% identical to Y3073_RHOS4: Uncharacterized HTH-type transcriptional regulator RHOS4_30730 (RHOS4_30730) from Rhodobacter sphaeroides (strain ATCC 17023 / 2.4.1 / NCIB 8253 / DSM 158)

KEGG orthology group: None (inferred from 100% identity to smk:Sinme_2062)

Predicted SEED Role

"Transcriptional regulator, GntR family domain / Aspartate aminotransferase (EC 2.6.1.1)" in subsystem Glutamine, Glutamate, Aspartate and Asparagine Biosynthesis or Threonine and Homoserine Biosynthesis (EC 2.6.1.1)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.6.1.1

Use Curated BLAST to search for 2.6.1.1

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q92NT7 at UniProt or InterPro

Protein Sequence (472 amino acids)

>SMc01406 transcriptional regulator (Sinorhizobium meliloti 1021)
MAVDRVDVSWVPALGRAGGPLYLAIADEIAADIAAGRLEDGVRLPPQRALAAALGIDFTT
VSRAYNEARRRGLVEGRVGQGTYVTARRRSAVRPSSGGLAGGLLGSLVDMSMNLPPLFDD
PALSEKMWADVAALDQRGPELLMRYQPVGGAERDRAAGAAWLKPRLGDLQADRLVVCTGA
QGALLASVGMLATKGDRICAEALTYPGLRSLAAHMGIELVSVGIDRNGILPDAFEEACAR
YKPKALYCNPTLHNPTTATLPLERREAIVAIARRHGVVVIEDDAYGALPANPVPPLAALA
PDLVFHIAGLAKCLSPALRIAYLVAPDRSAAVRLEGAIRATVGMTSPLSAAIATRWLEEG
TAQAVLAAIRTEAGARQRIAIKGLDGADLLADREGFHLWLKLPSRWSRGEFTAQLRMAGI
GVVASDAFAISDPPEAVRLGLGAARTRDELRHSLDVIAGLLAQFPAAHNLIV