Protein Info for SMc01370 in Sinorhizobium meliloti 1021

Annotation: response regulator PleD

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 455 PF00072: Response_reg" amino acids 5 to 116 (112 residues), 102.5 bits, see alignment E=1.5e-33 amino acids 156 to 265 (110 residues), 53.5 bits, see alignment E=2.6e-18 TIGR00254: diguanylate cyclase (GGDEF) domain" amino acids 289 to 453 (165 residues), 189.9 bits, see alignment E=1.4e-60 PF00990: GGDEF" amino acids 290 to 449 (160 residues), 169.4 bits, see alignment E=5.7e-54

Best Hits

KEGG orthology group: None (inferred from 100% identity to smk:Sinme_1090)

Predicted SEED Role

"Pole remodelling regulatory diguanylate cyclase" in subsystem ZZ gjo need homes

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q92QM5 at UniProt or InterPro

Protein Sequence (455 amino acids)

>SMc01370 response regulator PleD (Sinorhizobium meliloti 1021)
MTARILVVDDVPANVKLLEARLVAEYFDVLTAGDGHAALATCEKTPVDLVLLDIMMPGMD
GFEVCERLKANSRTAHIPVVMITALDQPSDRVRGLKAGADDFLTKPVNDLQLMSRVKSLV
RLKNVSDELRLRAQTAQTIGLQELARVDRPDEPGSVLLVDGRASSQERLTRALKPIADVA
VISDPQAALFEAAESSFDLIIVNANFDDYDPLRLCSQLRSLERTRFIPILLVTEQGNDER
IVRALELGVTDYIMRPVDPNELVARSLTQIRRKHCNDRLRASVQQTIELAVTDDLTGLHN
RRYLENHLKLLIDRATTRGRPLSICITDIDRFKRVNDTHGHDAGDDVLREFANRVRATVR
GADLACRFGGEEFVVVMPDTTPEMAAIVAERLRLAVESRGFDIPQAATVLNVTASLGIAT
LRPHGDTAEALLKRADMALYQAKNGGRNRVVAAAA