Protein Info for SMc01368 in Sinorhizobium meliloti 1021

Annotation: transport transmembrane protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 394 transmembrane" amino acids 20 to 44 (25 residues), see Phobius details amino acids 82 to 103 (22 residues), see Phobius details amino acids 109 to 131 (23 residues), see Phobius details amino acids 142 to 164 (23 residues), see Phobius details amino acids 170 to 189 (20 residues), see Phobius details amino acids 209 to 230 (22 residues), see Phobius details amino acids 247 to 266 (20 residues), see Phobius details amino acids 277 to 294 (18 residues), see Phobius details amino acids 300 to 322 (23 residues), see Phobius details amino acids 334 to 356 (23 residues), see Phobius details amino acids 368 to 389 (22 residues), see Phobius details PF07690: MFS_1" amino acids 27 to 246 (220 residues), 68.3 bits, see alignment E=3e-23 amino acids 218 to 391 (174 residues), 55.2 bits, see alignment E=2.9e-19

Best Hits

KEGG orthology group: None (inferred from 100% identity to sme:SMc01368)

Predicted SEED Role

"Transporter, MFS superfamily"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q92QM3 at UniProt or InterPro

Protein Sequence (394 amino acids)

>SMc01368 transport transmembrane protein (Sinorhizobium meliloti 1021)
MSKPPPGTSGPVDEIHWPSLIAALASITAVGIAIGLGLPLLSVIMEKRGIAPTLNGLNAA
MAGLASMAAAPFTMKFAHRHGVAPTMLLAIMFAAASSLGFYYLTNFWLWFPLRIVFHGAI
TVLFILSEFWINATAPPNRRGFVLGIYGTVLSLGFASGPLLFSILGSEGFLPFAVGAGVI
LLSAIPIFLARNESPVLDEKPKRHFMRYVFLVPTATAAVFIFGAVEYGGLSLFPIFGTRA
GFSESQAALLLTVMGVGNFIFQIPLGMLSDRVKDRRTILSALTLIGLVGALFLPTLVENW
FLMALVLLFWGGCVSGLYTVGLSHLGSRLQGADLAAANAAFVFSYAVGTVAGPQVIGAAM
DVTGNDGFAWAIAGFFGLYVVLSLVRIVLKPKRP