Protein Info for SMc01365 in Sinorhizobium meliloti 1021

Annotation: exoribonuclease II protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 750 789 TIGR02063: ribonuclease R" amino acids 41 to 752 (712 residues), 709.1 bits, see alignment E=6.3e-217 TIGR00358: VacB and RNase II family 3'-5' exoribonucleases" amino acids 156 to 739 (584 residues), 470.1 bits, see alignment E=1.1e-144 PF17876: CSD2" amino acids 211 to 274 (64 residues), 29.1 bits, see alignment E=1.3e-10 PF00773: RNB" amino acids 292 to 621 (330 residues), 316.8 bits, see alignment E=2.8e-98 PF00575: S1" amino acids 670 to 739 (70 residues), 40.2 bits, see alignment E=5.3e-14

Best Hits

KEGG orthology group: K12573, ribonuclease R [EC: 3.1.-.-] (inferred from 100% identity to sme:SMc01365)

Predicted SEED Role

"3'-to-5' exoribonuclease RNase R" in subsystem RNA processing and degradation, bacterial

Isozymes

Compare fitness of predicted isozymes for: 3.1.-.-

Use Curated BLAST to search for 3.1.-.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q92QM0 at UniProt or InterPro

Protein Sequence (789 amino acids)

>SMc01365 exoribonuclease II protein (Sinorhizobium meliloti 1021)
MTRIPRDPTETPAKGAGKKNGRAARTAPAGEKETIVHGVVPSREVLMRFIAENPQHASKR
EIAKAFGLKGEARVELKGLLRSLEEDGLVEKKRKSLVRPGGLPPVTVLDITIRDVDGDLI
GRPAEWLDDDGVAPAVLIKQSSVARAKGKTPVGGLGDRVLAKIFPAKERGGPAYTARIIK
VLDKRKDAVLGVFRATPGGGGRLMPIDKRGEELLIDPEFIGDAKEGDLVEAHLSRIGRYG
LPRAQVQNVVGSVASEKAISMIAIHAHGIPHVFPERVLQEAEAARPATMAHREDWRTLPL
ITIDPADAKDHDDAVYAEPDSSPDNPGGVIVTVAIADVSWYVRARSALDLEALKRGNSVY
FPDRVVPMLPERISNDLCSLKEGVDRPALAVRMRFSKEGRKAGHTFHRIMMRSAAKLSYQ
QAQTAIDGAPDDKTGPILDTILKPLWEAYRTLTRGRERRQPLELDVPERKIILKPDGTVD
RVFVPERLDAHKLIEEMMIQANVAAAETLEQKRQVLIYRVHDQPSLAKQESLREFLATLD
IALAKGGNMRANHFNGILAKADGKPYETIVNQMVLRSQSQAIYSPENIGHFGLNLLRYAH
FTSPIRRYADLIVHRALVSALGLGEGGIMPEEEAALDDIAAEISTFERRAMAAERDTIDR
LIAHHLNGRVGEEFDGRVSGVTKAGLFVTLPAYGADGFIPISTLGRDYFIYDEAHQALSG
EKSGLGYRLGDPVQVKLVEAVPLAGALRFEMLSEGRKMPTAMRSFHKAGRRDRTGARKRP
GTRPPRGRH