Protein Info for SMc01355 in Sinorhizobium meliloti 1021

Annotation: Holliday junction resolvase-like protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 165 PF03652: RuvX" amino acids 18 to 149 (132 residues), 139.3 bits, see alignment E=5.1e-45 TIGR00250: putative transcription antitermination factor YqgF" amino acids 21 to 149 (129 residues), 102.4 bits, see alignment E=1e-33

Best Hits

Swiss-Prot: 100% identical to YQGF_RHIME: Putative pre-16S rRNA nuclease (R01309) from Rhizobium meliloti (strain 1021)

KEGG orthology group: K07447, putative holliday junction resolvase [EC: 3.1.-.-] (inferred from 99% identity to smk:Sinme_1104)

Predicted SEED Role

"Putative Holliday junction resolvase YggF"

Isozymes

Compare fitness of predicted isozymes for: 3.1.-.-

Use Curated BLAST to search for 3.1.-.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q92QL0 at UniProt or InterPro

Protein Sequence (165 amino acids)

>SMc01355 Holliday junction resolvase-like protein (Sinorhizobium meliloti 1021)
MAILTMEELAERLPPYQSVAGLDLGTKTIGISVSDLGRRFATPREVIRRVKFGADAQALL
SFAEKEKIAAFIIGLPVNMDGSEGPRCQATRAFVRNMGEKTDIPFVLWDERLSTVAAERV
LIEMDVSRKKRAERIDSAAASFILQGALDRLASLARGASGDRDAP