Protein Info for SMc01354 in Sinorhizobium meliloti 1021

Annotation: metal-dependent hydrolase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 234 PF13483: Lactamase_B_3" amino acids 2 to 187 (186 residues), 60.6 bits, see alignment E=2.8e-20 PF00753: Lactamase_B" amino acids 5 to 74 (70 residues), 36.1 bits, see alignment E=1e-12 PF12706: Lactamase_B_2" amino acids 19 to 181 (163 residues), 61.3 bits, see alignment E=1.5e-20

Best Hits

Swiss-Prot: 100% identical to Y1310_RHIME: UPF0173 metal-dependent hydrolase R01310 (R01310) from Rhizobium meliloti (strain 1021)

KEGG orthology group: None (inferred from 99% identity to smk:Sinme_1105)

Predicted SEED Role

"metallo-beta-lactamase family protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q92QK9 at UniProt or InterPro

Protein Sequence (234 amino acids)

>SMc01354 metal-dependent hydrolase (Sinorhizobium meliloti 1021)
MNIKWLGHSAFHIETAKAKILIDPFFTGNPAFRDEERKAATAGLTHILLTHGHGDHVGDT
VAIAKETGATVLANFDLCMWLGRQGISKLEPGNTGGTIQLGSFTATFVNALHSSAQITDD
GVSHSLGNANGLVLHFDDEPTLYHMGDTEIFSDMALVQELHEPEIGIVPIGDRFTMGGAV
AALACQRYFKFNTTIPCHYGSFPIIDQTPETFIAGMDGASTLVATPEVGGAVTL