Protein Info for SMc01353 in Sinorhizobium meliloti 1021

Annotation: aspartyl/glutamyl-tRNA amidotransferase subunit C

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

Best Hits

Swiss-Prot: 100% identical to GATC_RHIME: Glutamyl-tRNA(Gln) amidotransferase subunit C (gatC) from Rhizobium meliloti (strain 1021)

KEGG orthology group: K02435, aspartyl-tRNA(Asn)/glutamyl-tRNA (Gln) amidotransferase subunit C [EC: 6.3.5.6 6.3.5.7] (inferred from 100% identity to smk:Sinme_1106)

MetaCyc: 39% identical to glutamyl-tRNAGln amidotransferase subunit C (Bacillus subtilis)
Glutaminyl-tRNA synthase (glutamine-hydrolyzing). [EC: 6.3.5.7]

Predicted SEED Role

"Aspartyl-tRNA(Asn) amidotransferase subunit C (EC 6.3.5.6) @ Glutamyl-tRNA(Gln) amidotransferase subunit C (EC 6.3.5.7)" (EC 6.3.5.6, EC 6.3.5.7)

MetaCyc Pathways

L-asparagine biosynthesis III (tRNA-dependent) (4/4 steps found)
glutaminyl-tRNA^gln biosynthesis via transamidation (4/4 steps found)
ammonia assimilation cycle III (3/3 steps found)
L-glutamate biosynthesis I (2/2 steps found)
L-glutamine degradation I (1/1 steps found)
L-citrulline biosynthesis (6/8 steps found)
L-glutamate and L-glutamine biosynthesis (5/7 steps found)
superpathway of L-citrulline metabolism (8/12 steps found)

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 6.3.5.6, 6.3.5.7

Use Curated BLAST to search for 6.3.5.6 or 6.3.5.7

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q92QK8 at UniProt or InterPro

Protein Sequence (95 amino acids)

>SMc01353 aspartyl/glutamyl-tRNA amidotransferase subunit C (Sinorhizobium meliloti 1021)
MSVDLATVKRVARLARIAVSDEEAERMTGELNGILGFVEQLSEVDVDGVEPMTSVMPMKM
KKRDDIVADGDKADDIVANAPNSDRNFFLVPKVVE