Protein Info for SMc01331 in Sinorhizobium meliloti 1021

Annotation: inorganic polyphosphate/ATP-NAD kinase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF01513: NAD_kinase
  • amino acids 9 to 84 (76 residues), 29.3 bits, E=9.9e-11
• PF20143: NAD_kinase_C
  • amino acids 116 to 218 (103 residues), 42 bits, E=7.4e-15

Best Hits

Swiss-Prot: 100% identical to NADK_RHIME: NAD kinase (nadK) from Rhizobium meliloti (strain 1021)

KEGG orthology group: K00858, NAD+ kinase [EC: 2.7.1.23] (inferred from 100% identity to smk:Sinme_1125)

Predicted SEED Role

"NAD kinase (EC 2.7.1.23)" in subsystem NAD and NADP cofactor biosynthesis global (EC 2.7.1.23)

MetaCyc Pathways

• cytosolic NADPH production (yeast) (4/5 steps found)
• NADP biosynthesis (1/1 steps found)
• superpathway of NAD/NADP - NADH/NADPH interconversion (yeast) (6/8 steps found)
• NAD phosphorylation and transhydrogenation (1/2 steps found)
• mitochondrial NADPH production (yeast) (3/5 steps found)
• NAD phosphorylation and dephosphorylation (1/3 steps found)
• NAD(P)/NADPH interconversion (3/6 steps found)

KEGG Metabolic Maps

• Nicotinate and nicotinamide metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.7.1.23

Sequence Analysis Tools

See Q92QJ0 at UniProt or InterPro

Protein Sequence (257 amino acids)

>SMc01331 inorganic polyphosphate/ATP-NAD kinase (Sinorhizobium meliloti 1021)
MARKFNSLAFIASPAEEAQKAAEDLRAVYGDHDPDKADVIVALGGDGFMLHTLHRTMNTG
KLVYGMNRGSVGFLMNRYSTENLHQRIANADENAFHPLEMRTTDVNGDKFTALAINEVYL
FRQSYQAAKLKVMVDGKTRLDELTCDGLLLATPAGSTAYNLSAHGPILPLEAPLLALTPV
SPFRPRRWRGALLPNHVTVDIEILEADKRPVNAVADHQEVKSVVHVRIAESEKLTARILS
DPDHSWSDRILAEQFSN