Protein Info for SMc01282 in Sinorhizobium meliloti 1021

Annotation: sulfite oxidase subunit YedZ

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 216 transmembrane" amino acids 15 to 34 (20 residues), see Phobius details amino acids 51 to 71 (21 residues), see Phobius details amino acids 82 to 101 (20 residues), see Phobius details amino acids 120 to 140 (21 residues), see Phobius details amino acids 154 to 172 (19 residues), see Phobius details amino acids 178 to 194 (17 residues), see Phobius details PF01794: Ferric_reduct" amino acids 51 to 163 (113 residues), 56.7 bits, see alignment E=1.3e-19

Best Hits

Swiss-Prot: 100% identical to MSRQ_RHIME: Protein-methionine-sulfoxide reductase heme-binding subunit MsrQ (msrQ) from Rhizobium meliloti (strain 1021)

KEGG orthology group: None (inferred from 100% identity to sme:SMc01282)

Predicted SEED Role

"FIG001196: Membrane protein YedZ"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q92QE8 at UniProt or InterPro

Protein Sequence (216 amino acids)

>SMc01282 sulfite oxidase subunit YedZ (Sinorhizobium meliloti 1021)
MRSLPALPKRLHGPSIWALYILGFLPAVWGFYLGATGRLPGNAVKEFEHLLGIWALRFLI
ATLAITPIRDLFGVNWLRYRRALGLLAFYYVMMHFLTYMVLDQTLLLPAIVADIARRPFI
TIGMAALVLLIPLAVTSNIWSIRRLGQRWNKLHRLVYVIAAAGALHFAMSVKVVGPEQML
YLFLVAVLVAWRAVRKRFLRWRRQGTAPMRSQARAG