Protein Info for SMc01280 in Sinorhizobium meliloti 1021

Annotation: protease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 465 signal peptide" amino acids 1 to 24 (24 residues), see Phobius details TIGR02037: peptidase Do" amino acids 39 to 462 (424 residues), 479 bits, see alignment E=7.2e-148 PF00089: Trypsin" amino acids 88 to 248 (161 residues), 70.7 bits, see alignment E=4.2e-23 PF13365: Trypsin_2" amino acids 91 to 226 (136 residues), 119.9 bits, see alignment E=3.7e-38 PF13180: PDZ_2" amino acids 268 to 357 (90 residues), 29.1 bits, see alignment E=2.4e-10 amino acids 398 to 445 (48 residues), 30.8 bits, see alignment 7.4e-11 PF17820: PDZ_6" amino acids 293 to 327 (35 residues), 39.1 bits, see alignment 1.3e-13 amino acids 403 to 439 (37 residues), 29.8 bits, see alignment 9.8e-11 PF00595: PDZ" amino acids 399 to 439 (41 residues), 29.1 bits, see alignment 2.7e-10

Best Hits

KEGG orthology group: K01362, [EC: 3.4.21.-] (inferred from 100% identity to sme:SMc01280)

Predicted SEED Role

"macromolecule metabolism; macromolecule degradation; degradation of proteins, peptides, glycopeptides"

Isozymes

Compare fitness of predicted isozymes for: 3.4.21.-

Use Curated BLAST to search for 3.4.21.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q92QE6 at UniProt or InterPro

Protein Sequence (465 amino acids)

>SMc01280 protease (Sinorhizobium meliloti 1021)
MIFGHRALAALVLAVAISTPAMAQDARTVPQSRSEMQLSFAPLVKQTANAVVNVYAERVV
ERRSIFAGDPFFEEFFGQRMPNRTEKQSSLGSGVIVGRNGLVVTNNHVIEGADDIKVALA
DGREFPCKIILKDDRLDLAVLKIQSDGPFDIVPIGDSDAVEVGDLVLAMGNPFGVGQTVT
SGIVSALARNQISNGDFGFFIQTDAAINPGNSGGGLINMKGELIGINTAIFSRGGGSNGV
GFAIPANLVKVFVASAEGGNGSFIRPFVGATFEPVTSDVAEALGLERARGALVTAVVAGG
PAESAGMRPGQVVTAVNGIPVEHPDALGYRLTTVGIGHEARVTVSENGGSREITLKLERA
PETQPRDERLIEGRNPFAGAVVANLSPRLAEELRMPTSLQGVVITEINRGSPAARIGLEP
KDIVRSVNGTAIDSSKTLESVVAEDASFWRVEIERNGQIIRQFFR