Protein Info for SMc01274 in Sinorhizobium meliloti 1021

Annotation: camphor resistance protein CrcB

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 125 signal peptide" amino acids 1 to 19 (19 residues), see Phobius details transmembrane" amino acids 34 to 55 (22 residues), see Phobius details amino acids 67 to 89 (23 residues), see Phobius details amino acids 100 to 121 (22 residues), see Phobius details PF02537: CRCB" amino acids 5 to 118 (114 residues), 108.9 bits, see alignment E=8e-36 TIGR00494: protein CrcB" amino acids 5 to 120 (116 residues), 96.7 bits, see alignment E=5.7e-32

Best Hits

Swiss-Prot: 100% identical to CRCB_RHIME: Putative fluoride ion transporter CrcB (crcB) from Rhizobium meliloti (strain 1021)

KEGG orthology group: K06199, CrcB protein (inferred from 98% identity to smk:Sinme_1184)

Predicted SEED Role

"Protein crcB homolog"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q92QE1 at UniProt or InterPro

Protein Sequence (125 amino acids)

>SMc01274 camphor resistance protein CrcB (Sinorhizobium meliloti 1021)
MNHILLVGAGGALGSVLRYLVGLWMLQRAGPAFPWGTLFVNVTGSFLIGFLAEFIMHKMG
ASPEMRVFLITGVLGGYTTFSAFSLDAIALLEHGQTMSGLAYIVASVGLSMLAVFAGLAL
MRAMV