Protein Info for SMc01258 in Sinorhizobium meliloti 1021

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 340 transmembrane" amino acids 24 to 45 (22 residues), see Phobius details amino acids 65 to 84 (20 residues), see Phobius details amino acids 95 to 115 (21 residues), see Phobius details amino acids 121 to 141 (21 residues), see Phobius details amino acids 147 to 167 (21 residues), see Phobius details amino acids 189 to 208 (20 residues), see Phobius details amino acids 238 to 259 (22 residues), see Phobius details PF07786: HGSNAT_cat" amino acids 23 to 246 (224 residues), 259.6 bits, see alignment E=2.3e-81

Best Hits

KEGG orthology group: None (inferred from 100% identity to sme:SMc01258)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q92KE6 at UniProt or InterPro

Protein Sequence (340 amino acids)

>SMc01258 hypothetical protein (Sinorhizobium meliloti 1021)
MSEHSATTTPEAQMRTEATGTNRMVLLDALRGLALVAMALYHFVWDLEFFGYVAAGTAGT
GGWRMFARLIASSFLFLAGYSLVLGQLPKLRPRAFAIRFAKIAGAAALISIGTWFAFPQS
FIFFGILHAIAAASLVGLLFLKLPAAVSFLAAAVAFAAPLYLRSSFFDMPALWWVGLSET
IPRSNDYVPLLPWIAPFLLGLGTAKLLHPLFSARRSRSAGTRKHPWMTPLAFGGRHSLLI
YLIHQPLLIAAVYLFSLAVPAPAPDPARVYLLNCERACSNENSGISCSAFCGCTLAGLKE
QNLFDDLNLGKIDVNTDERIARIAGQCTMDAQSGEAQSGD