Protein Info for SMc01256 in Sinorhizobium meliloti 1021

Annotation: L-serine dehydratase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 466 TIGR00720: L-serine ammonia-lyase" amino acids 4 to 463 (460 residues), 622.2 bits, see alignment E=2.9e-191 PF03315: SDH_beta" amino acids 4 to 161 (158 residues), 186 bits, see alignment E=5.9e-59 PF03313: SDH_alpha" amino acids 195 to 460 (266 residues), 307.6 bits, see alignment E=8.8e-96

Best Hits

KEGG orthology group: K01752, L-serine dehydratase [EC: 4.3.1.17] (inferred from 100% identity to smk:Sinme_1204)

Predicted SEED Role

No annotation

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 4.3.1.17

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q92QC5 at UniProt or InterPro

Protein Sequence (466 amino acids)

>SMc01256 L-serine dehydratase (Sinorhizobium meliloti 1021)
MFLSVFDVFKIGIGPSSSHTMGPMSAANRFLDLILSDEWPRPSHAAVGAIKVSLHGSLAH
TGIGHGTGRAVILGLMGERPDLVEPDGMDGIIEQVERTGRITPPGHAGYMFQPKTDLVFD
KKTPLPGHANGMSFSAFDRDGRLLLKRIYYSIGGGFVVTDTELDAMRAQKNKPAGVKVPY
PFATAQQMLDMAARSGLTIAQMKRANEECRMSRDELDAGLDRIWTAMSSCIDRGLSQDGI
MPGGLKVRRRARAIHDKLQEEWRSNKTNPLLANDWLSVYAMAVNEENAAGGRVVTSPTNG
AAGVVPATIRYYLHFHDDADQEGIRDYLLTAAAIGGIIKHNASISGAEVGCQGEVGSASA
MAAAGLAAVMGGTPEQIENAAEIALEHHLGMTCDPVAGLVQVPCIERNALGAVKAVTAAS
LALKGDGKHFVPLDACIETMRQTGADMNEKYKETSTGGLAVNVVEC