Protein Info for SMc01221 in Sinorhizobium meliloti 1021

Annotation: lipopolysaccharide core biosynthesis glycosyl transferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 343 PF13439: Glyco_transf_4" amino acids 12 to 147 (136 residues), 33.3 bits, see alignment E=1.2e-11 PF00534: Glycos_transf_1" amino acids 159 to 315 (157 residues), 97 bits, see alignment E=2.4e-31 PF13692: Glyco_trans_1_4" amino acids 170 to 304 (135 residues), 81.6 bits, see alignment E=1.7e-26 PF13524: Glyco_trans_1_2" amino acids 246 to 330 (85 residues), 28.4 bits, see alignment E=4e-10

Best Hits

Swiss-Prot: 100% identical to LPSD_RHIME: Lipopolysaccharide core biosynthesis glycosyltransferase LpsD (lpsD) from Rhizobium meliloti (strain 1021)

KEGG orthology group: None (inferred from 100% identity to sme:SMc01221)

Predicted SEED Role

"Lipopolysaccharide core biosynthesis glycosyltransferase lpsD (EC 2.-.-.-)" (EC 2.-.-.-)

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.-.-.-

Use Curated BLAST to search for 2.-.-.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q9R9N0 at UniProt or InterPro

Protein Sequence (343 amino acids)

>SMc01221 lipopolysaccharide core biosynthesis glycosyl transferase (Sinorhizobium meliloti 1021)
MKVMHIHFGTEGGAERFFVNLVNALHERGVEQRALIRPGRSWRKDLENGATIYEGVFRRI
SLSRFLLKWRMNRVLREFEPDVIMAWQLRASRFMPAHAKAFRISRLGDYPEHLGYYTNVQ
TLVCITPDMAAKVRELGWKRDIEVIANFTRARPAPPVARADLQTPADAFVVVGMGRFVKR
KGFAGLIRAVKEVENTYLWLVGDGPEREQLEQLTDELGLRDRVRFTGWQTNAYGFLSAGD
AFVINSSHEPLGNVCFEGWGAGKPTIASRAEGPSWVMTHESDALMVDCGDDVGLAAAIRR
LRDDPALRERLSAGGSETLRTRFSEKAITDAYLDLFDRGVAKR