Protein Info for SMc01219 in Sinorhizobium meliloti 1021

Annotation: lipopolysaccharide core biosynthesis mannosyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 351 PF20706: GT4-conflict" amino acids 147 to 317 (171 residues), 40.6 bits, see alignment E=2.5e-14 PF00534: Glycos_transf_1" amino acids 153 to 325 (173 residues), 107.5 bits, see alignment E=8.8e-35 PF13692: Glyco_trans_1_4" amino acids 168 to 314 (147 residues), 110.1 bits, see alignment E=1.6e-35

Best Hits

Swiss-Prot: 100% identical to LPSB_RHIME: Lipopolysaccharide core biosynthesis mannosyltransferase LpsB (lpsB) from Rhizobium meliloti (strain 1021)

KEGG orthology group: K12989, mannosyltransferase [EC: 2.4.1.-] (inferred from 100% identity to sme:SMc01219)

MetaCyc: 56% identical to LPS core oligosaccharide mannosyltransferase WadC (Brucella abortus 2308)
2.4.1.-

Predicted SEED Role

"Glycosyltransferase"

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.4.1.-

Use Curated BLAST to search for 2.4.1.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q9R9N2 at UniProt or InterPro

Protein Sequence (351 amino acids)

>SMc01219 lipopolysaccharide core biosynthesis mannosyltransferase (Sinorhizobium meliloti 1021)
MVDIRDVEVIAPNFKQRLSGVTSTIIQLVPVQRALGQKIAVLGPGLPKSLPSVRFRDLIH
LWKRPEGRPCRVWHARRNVEMLPAILLRDLLRMKLRIVFTSASQRRHTGWSKFLIRRMDA
VIATSGRTAAYLDVPNTVILHGIDTKRFQPPFDKTEAKKALGLDPAKKFVGCFGRVRHQK
GTDLFVDSMIALLPCRPDWGAIVAGRATGPHLAFESELKERVAKAGLADRILFVGEHTNI
PDWYRALDLFVAPQRWEGFGLTPLEAMATGVPVVATDVGAFSELVTGGSEETGLIIAADD
LKAMVDAAAAFMDDRPRLAAASANGLARTSKNFAIEQEARAIAAVYESLMR