Protein Info for SMc01219 in Sinorhizobium meliloti 1021

Annotation: lipopolysaccharide core biosynthesis mannosyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF20706: GT4-conflict
  • amino acids 147 to 317 (171 residues), 40.1 bits, E=4.7e-14
• PF00534: Glycos_transf_1
  • amino acids 153 to 325 (173 residues), 107.5 bits, E=1.2e-34
• PF13692: Glyco_trans_1_4
  • amino acids 168 to 314 (147 residues), 104.3 bits, E=1.4e-33
• PF13524: Glyco_trans_1_2
  • amino acids 253 to 342 (90 residues), 30.3 bits, E=7.8e-11

Best Hits

Swiss-Prot: 100% identical to LPSB_RHIME: Lipopolysaccharide core biosynthesis mannosyltransferase LpsB (lpsB) from Rhizobium meliloti (strain 1021)

KEGG orthology group: K12989, mannosyltransferase [EC: 2.4.1.-] (inferred from 100% identity to sme:SMc01219)

MetaCyc: 56% identical to LPS core oligosaccharide mannosyltransferase WadC (Brucella abortus 2308)
2.4.1.-

Predicted SEED Role

"Glycosyltransferase"

MetaCyc Pathways

• lipid A-core biosynthesis (Brucella) (2/7 steps found)

KEGG Metabolic Maps

• Anthocyanin biosynthesis
• Carotenoid biosynthesis - General
• Flavone and flavonol biosynthesis
• Flavonoid biosynthesis
• Fructose and mannose metabolism
• Glycerolipid metabolism
• Glycosphingolipid biosynthesis - ganglio series
• Glycosphingolipid biosynthesis - globo series
• Glycosphingolipid biosynthesis - lacto and neolacto series
• Glycosylphosphatidylinositol(GPI)-anchor biosynthesis
• High-mannose type N-glycan biosynthesis
• Keratan sulfate biosynthesis
• Lipopolysaccharide biosynthesis
• N-Glycan biosynthesis
• O-Glycan biosynthesis
• O-Mannosyl glycan biosynthesis
• Peptidoglycan biosynthesis
• Sphingolipid metabolism
• Zeatin biosynthesis

Isozymes

Compare fitness of predicted isozymes for: 2.4.1.-

Use Curated BLAST to search for 2.4.1.-

Sequence Analysis Tools

See Q9R9N2 at UniProt or InterPro

Protein Sequence (351 amino acids)

>SMc01219 lipopolysaccharide core biosynthesis mannosyltransferase (Sinorhizobium meliloti 1021)
MVDIRDVEVIAPNFKQRLSGVTSTIIQLVPVQRALGQKIAVLGPGLPKSLPSVRFRDLIH
LWKRPEGRPCRVWHARRNVEMLPAILLRDLLRMKLRIVFTSASQRRHTGWSKFLIRRMDA
VIATSGRTAAYLDVPNTVILHGIDTKRFQPPFDKTEAKKALGLDPAKKFVGCFGRVRHQK
GTDLFVDSMIALLPCRPDWGAIVAGRATGPHLAFESELKERVAKAGLADRILFVGEHTNI
PDWYRALDLFVAPQRWEGFGLTPLEAMATGVPVVATDVGAFSELVTGGSEETGLIIAADD
LKAMVDAAAAFMDDRPRLAAASANGLARTSKNFAIEQEARAIAAVYESLMR