Protein Info for SMc01212 in Sinorhizobium meliloti 1021

Annotation: transport transmembrane protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 415 transmembrane" amino acids 12 to 32 (21 residues), see Phobius details amino acids 52 to 69 (18 residues), see Phobius details amino acids 81 to 104 (24 residues), see Phobius details amino acids 110 to 127 (18 residues), see Phobius details amino acids 139 to 161 (23 residues), see Phobius details amino acids 167 to 188 (22 residues), see Phobius details amino acids 219 to 243 (25 residues), see Phobius details amino acids 255 to 274 (20 residues), see Phobius details amino acids 286 to 304 (19 residues), see Phobius details amino acids 309 to 327 (19 residues), see Phobius details amino acids 346 to 369 (24 residues), see Phobius details amino acids 381 to 401 (21 residues), see Phobius details PF12832: MFS_1_like" amino acids 13 to 160 (148 residues), 28.2 bits, see alignment E=1.6e-10 PF07690: MFS_1" amino acids 14 to 359 (346 residues), 171.7 bits, see alignment E=3.3e-54 amino acids 227 to 397 (171 residues), 34.2 bits, see alignment E=2e-12 PF00083: Sugar_tr" amino acids 47 to 190 (144 residues), 58.6 bits, see alignment E=8.5e-20

Best Hits

KEGG orthology group: K08151, MFS transporter, DHA1 family, tetracycline resistance protein (inferred from 100% identity to sme:SMc01212)

Predicted SEED Role

"Tetracycline efflux protein TetA"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q92PZ1 at UniProt or InterPro

Protein Sequence (415 amino acids)

>SMc01212 transport transmembrane protein (Sinorhizobium meliloti 1021)
MLDKKFVRRGLFLVFLILFLDIMGIAIIVPVLPTYLEELTGADIGEAAVDGGWLLLVYSA
MQFLFAPLIGNLSDRFGRRPVLLASVLTFALDNLICALATSYWMLFIGRSLAGISGASFG
TASAYIADVSDDENRAKNFGLIGIAFGTGFALGPVIGGFLGELGPRVPFYGAAALSFLNF
IMGVFLLPETLAPANRRRFEWHRANPLGALKQMRHYPGIGWVGLVFFLYWLAHAVYPAVW
SFVGSYRYGWSEGQIGLSLGIFGVGGAIVMALVLPRVVPALGERRTAALGLTFTALGMAG
YAAAWEGWMVYAVIVATALESLADPPLRSIASVHVPPSAQGELQGALTSISSITTILGPL
MFTQIFAFFTDPAAAHSFAGAPYALAGCLIVAALVIFLAKVGAGRGGAVRGAVRA