Protein Info for SMc01146 in Sinorhizobium meliloti 1021

Annotation: deoxyribonucleotide triphosphate pyrophosphatase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF01725: Ham1p_like
  • amino acids 9 to 209 (201 residues), 200.6 bits, E=1.1e-63
• TIGR00042: non-canonical purine NTP pyrophosphatase, RdgB/HAM1 family
  • amino acids 9 to 210 (202 residues), 156 bits, E=3.6e-50

Best Hits

Swiss-Prot: 100% identical to IXTPA_RHIME: dITP/XTP pyrophosphatase (R00374) from Rhizobium meliloti (strain 1021)

KEGG orthology group: K01516, nucleoside-triphosphatase [EC: 3.6.1.15] (inferred from 100% identity to sme:SMc01146)

Predicted SEED Role

"Nucleoside 5-triphosphatase RdgB (dHAPTP, dITP, XTP-specific) (EC 3.6.1.15)" in subsystem Heat shock dnaK gene cluster extended (EC 3.6.1.15)

MetaCyc Pathways

• superpathway of pyrimidine deoxyribonucleotides de novo biosynthesis (17/18 steps found)
• pyrimidine deoxyribonucleotides de novo biosynthesis I (9/9 steps found)
• superpathway of pyrimidine deoxyribonucleotides de novo biosynthesis (E. coli) (12/14 steps found)
• pyrimidine deoxyribonucleotides de novo biosynthesis III (8/9 steps found)
• pyrimidine deoxyribonucleotides biosynthesis from CTP (7/8 steps found)
• pyrimidine deoxyribonucleotides de novo biosynthesis IV (6/7 steps found)
• UTP and CTP dephosphorylation I (5/7 steps found)

KEGG Metabolic Maps

• Purine metabolism
• Thiamine metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.6.1.15

Sequence Analysis Tools

See Q92SK4 at UniProt or InterPro

Protein Sequence (214 amino acids)

>SMc01146 deoxyribonucleotide triphosphate pyrophosphatase (Sinorhizobium meliloti 1021)
MRRLIDKTLVVASHNAGKIREIRDLIGPLGFEAKSAADLNFVEPDETGTTFEENATIKAL
ASAKASGLPALSDDSGLAVDALGGAPGVYTANWAEREDGSRDFQMAMEKVEEALRAKGAV
KPESRTARFVSVLCLAWPDGHVELFRGEVEGYVVWPPRGTSGFGYDPVFQPKGYDTTFGE
MSAEEKHGWKPGDSEALSHRARAFKLFAETCLGA