Protein Info for SMc01142 in Sinorhizobium meliloti 1021

Annotation: heat shock protein GrpE

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 208 PF01025: GrpE" amino acids 27 to 193 (167 residues), 184.1 bits, see alignment E=8.3e-59

Best Hits

Swiss-Prot: 100% identical to GRPE_RHIME: Protein GrpE (grpE) from Rhizobium meliloti (strain 1021)

KEGG orthology group: K03687, molecular chaperone GrpE (inferred from 100% identity to smk:Sinme_0011)

MetaCyc: 38% identical to nucleotide exchange factor GrpE (Escherichia coli K-12 substr. MG1655)

Predicted SEED Role

"Heat shock protein GrpE" in subsystem Heat shock dnaK gene cluster extended or Protein chaperones

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q92SK0 at UniProt or InterPro

Protein Sequence (208 amino acids)

>SMc01142 heat shock protein GrpE (Sinorhizobium meliloti 1021)
MTDETNKNGPEAAAPEEFETAAEPQAAEKPEADASTTAPDPLELARAESAELRDKYLRLA
AEMDNLRRRTERDVKDAKSYSVAGFARDMLAVSDNLRRALDAIPADAREAGDAGLKALIE
GVEMTERSMLAALERHGVKQLDPTGQKFDPNFHQAMFEVPNTEVPNNTVVQVVQAGYTIG
ERVLRPAMVGVAKGGPKAATSESETPAA