Protein Info for SMc01138 in Sinorhizobium meliloti 1021

Annotation: ABC transporter ATP-binding protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 270 TIGR04406: LPS export ABC transporter ATP-binding protein" amino acids 34 to 270 (237 residues), 377.7 bits, see alignment E=9.6e-118 PF00005: ABC_tran" amino acids 49 to 195 (147 residues), 122.7 bits, see alignment E=8.9e-40

Best Hits

Swiss-Prot: 100% identical to Y382_RHIME: Uncharacterized ABC transporter ATP-binding protein R00382 (R00382) from Rhizobium meliloti (strain 1021)

KEGG orthology group: K06861, lipopolysaccharide export system ATP-binding protein [EC: 3.6.3.-] (inferred from 100% identity to smk:Sinme_0015)

MetaCyc: 79% identical to lipopolysaccharide transport system ATP-binding protein (Brucella abortus 2308)
TRANS-RXN2B4Q-128 [EC: 7.5.2.5]

Predicted SEED Role

"Lipopolysaccharide ABC transporter, ATP-binding protein LptB" in subsystem KDO2-Lipid A biosynthesis

MetaCyc Pathways

Isozymes

Compare fitness of predicted isozymes for: 3.6.3.-

Use Curated BLAST to search for 3.6.3.- or 7.5.2.5

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See P25885 at UniProt or InterPro

Protein Sequence (270 amino acids)

>SMc01138 ABC transporter ATP-binding protein (Sinorhizobium meliloti 1021)
MQIPFLHKRKRGKKPSAAAAAARAVDKARYDGTLIARGLTKSYRSRRVVNGVSLVVRRGE
AVGLLGPNGAGKTTCFYMITGLVPVDEGSIEINGNDVTTMPMYRRARLGVGYLPQEASIF
RGLTVEDNIRAVLEVHDENVDRRESKLNDLLGEFSITHLRKSPAIALSGGERRRLEIARA
LATDPTFMLLDEPFAGVDPISVADIQALVRHLTSRGIGVLITDHNVRETLGLIDRAYIIH
AGEVLTHGRANDIVTNPDVRRLYLGDNFSL