Protein Info for SMc01137 in Sinorhizobium meliloti 1021

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 186 signal peptide" amino acids 1 to 32 (32 residues), see Phobius details PF03968: LptD_N" amino acids 50 to 163 (114 residues), 80.2 bits, see alignment E=6.9e-27

Best Hits

Swiss-Prot: 100% identical to Y383_RHIME: Uncharacterized protein R00383 (R00383) from Rhizobium meliloti (strain 1021)

KEGG orthology group: K09774, lipopolysaccharide export system protein LptA (inferred from 100% identity to sme:SMc01137)

MetaCyc: 40% identical to lipopolysaccharide transport system protein LptA (Brucella abortus 2308)
TRANS-RXN2B4Q-128 [EC: 7.5.2.5]

Predicted SEED Role

"FIG01074166: hypothetical protein"

MetaCyc Pathways

Isozymes

No predicted isozymes

Use Curated BLAST to search for 7.5.2.5

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See P25893 at UniProt or InterPro

Protein Sequence (186 amino acids)

>SMc01137 hypothetical protein (Sinorhizobium meliloti 1021)
MSVKPAALFRISAALAVAGLGASLIASAALAQATSSRMQGLQLSNDQPIQIESDKLEIKD
PESKAIFTGNVKVVQGTTTLQAGNMTVFYKAGGGSVTSGNADIDRIEVSNKVFLSSGAQQ
ATGESGIVNLTNQTIVLKGKKVVLSEGKNVFVGCQLNVQMDTGEAQLDACGGRVQIQLDP
QSRKTN