Protein Info for SMc01129 in Sinorhizobium meliloti 1021

Annotation: lipoprotein signal peptidase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 166 transmembrane" amino acids 12 to 32 (21 residues), see Phobius details amino acids 68 to 86 (19 residues), see Phobius details amino acids 98 to 118 (21 residues), see Phobius details amino acids 129 to 152 (24 residues), see Phobius details TIGR00077: signal peptidase II" amino acids 10 to 161 (152 residues), 130.2 bits, see alignment E=3.3e-42 PF01252: Peptidase_A8" amino acids 18 to 155 (138 residues), 128.5 bits, see alignment E=1.1e-41

Best Hits

Swiss-Prot: 100% identical to LSPA_RHIME: Lipoprotein signal peptidase (lspA) from Rhizobium meliloti (strain 1021)

KEGG orthology group: K03101, signal peptidase II [EC: 3.4.23.36] (inferred from 100% identity to smk:Sinme_0024)

MetaCyc: 37% identical to lipoprotein signal peptidase (Escherichia coli K-12 substr. MG1655)
Signal peptidase II. [EC: 3.4.23.36]

Predicted SEED Role

"Lipoprotein signal peptidase (EC 3.4.23.36)" in subsystem Sex pheromones in Enterococcus faecalis and other Firmicutes or Signal peptidase (EC 3.4.23.36)

MetaCyc Pathways

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.4.23.36

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q92SJ3 at UniProt or InterPro

Protein Sequence (166 amino acids)

>SMc01129 lipoprotein signal peptidase (Sinorhizobium meliloti 1021)
MRQEQTLFSRPLPIALFILIALAADQFIKYLVEAYLPFQQGVPVMPMLALYRTYNYGVAF
SMLSGMEGWFIVGIRLAVVTFVLWLWRRTPKDRFFAHLGYAMIIAGALGNLVDRLLFGYV
IDYILFYTATWSFAVFNLADSFITVGAGAIILDELLQAKKERSLKL