Protein Info for SMc01125 in Sinorhizobium meliloti 1021

Annotation: DNA mismatch repair protein MutS

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 750 800 850 916 PF01624: MutS_I" amino acids 30 to 146 (117 residues), 152.5 bits, see alignment E=1.2e-48 TIGR01070: DNA mismatch repair protein MutS" amino acids 30 to 911 (882 residues), 845.9 bits, see alignment E=2e-258 PF05188: MutS_II" amino acids 155 to 284 (130 residues), 89.6 bits, see alignment E=5.9e-29 PF05192: MutS_III" amino acids 303 to 601 (299 residues), 144.6 bits, see alignment E=1.2e-45 PF05190: MutS_IV" amino acids 465 to 560 (96 residues), 79.2 bits, see alignment E=5.9e-26 PF00488: MutS_V" amino acids 661 to 848 (188 residues), 288.4 bits, see alignment E=7.4e-90

Best Hits

Swiss-Prot: 80% identical to MUTS_RHIEC: DNA mismatch repair protein MutS (mutS) from Rhizobium etli (strain CFN 42 / ATCC 51251)

KEGG orthology group: K03555, DNA mismatch repair protein MutS (inferred from 82% identity to ara:Arad_0639)

Predicted SEED Role

"DNA mismatch repair protein MutS" in subsystem DNA repair, bacterial MutL-MutS system

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See P56883 at UniProt or InterPro

Protein Sequence (916 amino acids)

>SMc01125 DNA mismatch repair protein MutS (Sinorhizobium meliloti 1021)
MNFLMDASNRSGDVLSVSDLASEESRSTATPMMEQFIEIKANNPDSLLFYRMGDFYELFF
QDAVEASRALGITLTKRGQHMGQEIPMCGVPVHAADDYLQKLIASGYRVAVCEQVEDPAE
AKKRGSKSVVRRDVVRLVTPGTITEDKLLSPSESNYLMALARIRSGSEPAYALAWIDIST
GIFRLAETAESRLLADILRIEPRELILPDTVFHDPDLRPVFDVLGRVAVPQPAVLFDSAT
AEGRISRYYGVGTLDGFGSFSRAELAAASAAVSYVEKTQLQERPALGIPERESAASTLFI
DPATRANLELAKTLSGSRDGSLLKSLDRTMTSGGARLLAERLMSPLTDPERINQRLDSIE
VLADQPRFTTDVRDALRRAPDMPRALSRLALGRGGPRDLGAIQAGMRAAAAISALLSGAE
LSAELTEARDAIAALPGELLARLDATLAEELPLLKRDGGFVREGASAELDEMRALRDQSR
RVIAGLQLQYCEETGIKSLKIKHNNVLGYFIEVTAGNAGSMTDTDAGRARFIHRQTMANA
MRFTTTELAELETKIANAADRALAIELETFEAMVREVVAEAEAIKAAALALATIDVSAGL
AVLAEEQNYTRPTVDRSRMFAIDGGRHPVVEQALRRQAANPFVANGCDLSPPNGEQGGAI
WLLTGPNMGGKSTFLRQNALIAIMAQTGSFVPAAAAHIGVVDRLFSRVGASDDLARGRST
FMVEMVETAAILNQATDRSLVILDEIGRGTATFDGLSIAWAAVEHLHEVNRCRGLFATHF
HELTVLSEKLVRLSNATMRVKEWDGDVIFLHEVGPGAADRSYGIQVARLAGLPASVVARA
RDVLAKLEDADRKNPASQLIDDLPLFQVAVRREEAARASSGPSKVEEALKALNPDDMTPR
EALDALYALKKELSNR