Protein Info for SMc01121 in Sinorhizobium meliloti 1021

Annotation: tryptophanyl-tRNA synthetase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 354 TIGR00233: tryptophan--tRNA ligase" amino acids 6 to 352 (347 residues), 285.9 bits, see alignment E=2.3e-89 PF00579: tRNA-synt_1b" amino acids 7 to 301 (295 residues), 232.4 bits, see alignment E=3.8e-73

Best Hits

Swiss-Prot: 100% identical to SYW_RHIME: Tryptophan--tRNA ligase (trpS) from Rhizobium meliloti (strain 1021)

KEGG orthology group: K01867, tryptophanyl-tRNA synthetase [EC: 6.1.1.2] (inferred from 100% identity to smk:Sinme_0032)

Predicted SEED Role

"Tryptophanyl-tRNA synthetase (EC 6.1.1.2)" (EC 6.1.1.2)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 6.1.1.2

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q92SI9 at UniProt or InterPro

Protein Sequence (354 amino acids)

>SMc01121 tryptophanyl-tRNA synthetase (Sinorhizobium meliloti 1021)
MNEFKPLVFSGVQPTGNLHLGNYLGAIRKFVALQENNDCIYCVVDLHSITAQLVHEDLPG
QIRSIAAAFIASGIDPEKHIVFNQSAVPQHAELAWIFNCVARIGWMNRMTQFKDKAGKDR
ENASLGLLAYPSLMAADILVYRATHVPVGDDQKQHLELTRDIAQKFNIDFMEHIRRGGYG
VDIVVGEEPIHAYFPPVEPLIGGPAPRVMSLRDGTKKMSKSDPSDLSRINLMDDADTILK
KIRKAKTDPDALPSEADGLKDRPEAENLVGIYAALADRSKEEVLAEFGGQQFSTFKPALA
DLAVSVLSPITGEMRRLMGDTAHIDAILRKGGERARERAETTMREVREIIGFLQ