Protein Info for SMc01103 in Sinorhizobium meliloti 1021

Updated annotation (from data): Ribokinase (EC 2.7.1.15)
Rationale: Specifically important for utilizing D-Ribose. Automated validation from mutant phenotype: the predicted function (RIBOKIN-RXN) was linked to the condition via a MetaCyc pathway. This annotation was also checked manually.
Original annotation: ribokinase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 299 PF00294: PfkB" amino acids 2 to 290 (289 residues), 199 bits, see alignment E=1.2e-62 PF08543: Phos_pyr_kin" amino acids 171 to 273 (103 residues), 31.6 bits, see alignment E=1.1e-11

Best Hits

KEGG orthology group: K00852, ribokinase [EC: 2.7.1.15] (inferred from 100% identity to sme:SMc01103)

Predicted SEED Role

"Ribokinase (EC 2.7.1.15)" in subsystem D-ribose utilization or Deoxyribose and Deoxynucleoside Catabolism (EC 2.7.1.15)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.7.1.15

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q92SH8 at UniProt or InterPro

Protein Sequence (299 amino acids)

>SMc01103 Ribokinase (EC 2.7.1.15) (Sinorhizobium meliloti 1021)
MITVFGSINMDLIATTARLPKPGETVAGTDFSTAAGGKGANQALAARRAGASVRMAGAVG
SDAFAEGALALLKEAGTDLDLTKTVGEPTGTAHIIVGGDGENVIVVVASANARVSGDDAA
NVVAQMSAGDTLMLQLEIPSASVEKALSEAKRRGIRSIINIAPLTPDAARLGRMADIVIA
NETEFELLAGKAGIAGAEREEAMNGLHAETRQTVIVTLGAEGVVAIHEGELHRAKGLTIE
PVDTVGAGDTFCGYLAAGLDAGLAFSEALRRAAIAGSLACLKPGAQPSIPLAAEVAARL