Protein Info for SMc01094 in Sinorhizobium meliloti 1021

Annotation: multidrug efflux system transmembrane protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 402 signal peptide" amino acids 1 to 27 (27 residues), see Phobius details TIGR01730: efflux transporter, RND family, MFP subunit" amino acids 54 to 390 (337 residues), 287.8 bits, see alignment E=4.6e-90 PF25917: BSH_RND" amino acids 79 to 220 (142 residues), 80.6 bits, see alignment E=2.1e-26 PF25878: HH_AAEA_pHBA" amino acids 115 to 186 (72 residues), 29.9 bits, see alignment E=2.2e-10 PF25876: HH_MFP_RND" amino acids 120 to 188 (69 residues), 44.7 bits, see alignment E=4.8e-15 PF25944: Beta-barrel_RND" amino acids 226 to 313 (88 residues), 44.6 bits, see alignment E=5.7e-15 PF25954: Beta-barrel_RND_2" amino acids 259 to 315 (57 residues), 41.2 bits, see alignment 5.3e-14 PF25967: RND-MFP_C" amino acids 323 to 381 (59 residues), 40.8 bits, see alignment E=6.1e-14

Best Hits

KEGG orthology group: None (inferred from 100% identity to smk:Sinme_0058)

Predicted SEED Role

"RND efflux system, membrane fusion protein CmeA" in subsystem Multidrug Resistance Efflux Pumps or Multidrug efflux pump in Campylobacter jejuni (CmeABC operon)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q92SG9 at UniProt or InterPro

Protein Sequence (402 amino acids)

>SMc01094 multidrug efflux system transmembrane protein (Sinorhizobium meliloti 1021)
MTSTVTRRVLWGAGLSILLSVGGGAAVFFGLPQRFQADAATEAPAAAVPPAVPVSVAKAE
SRRITTWESFSGRLEAIERVEIRPRVGGAILSAHFREGALVEKGDLLVTIDPEPFAAAVE
RAEAQVAAAEARVALARTELERGRKLVTTSAIPQSGVDQRLSVYDEARANLRSAKAALHT
AKLDLEYTEVRAPISGRVGRLNVTAGNLVTAGTASPVLTTLVSVDPIYASFNVSEEVVAA
ALAKLSASAGSIDAIERIPVEIGTSADEGTPITGHIQLINNEVDAATGTIRVRAELTNAD
GRLIPGQFVRIRIGDPQPEEKLVISDRAVSSDQDKKFVLVVGADNKVEYRQVTLGPVADG
LRIVENGLKPGESIIVNGLQRVRPGVVVAPQAEQATASIAKP