Protein Info for SMc01054 in Sinorhizobium meliloti 1021
Updated annotation (from data): required for sulfate utilization, putative electron source for sulfite reductase CysI
Rationale: PFam PF11011.4 (DUF2849). conserved cofit with sulfite reductase and has a complementary pattern of gene presence as cysJ
Original annotation: hypothetical protein
These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.
Protein Families and Features
Best Hits
KEGG orthology group: None (inferred from 99% identity to smd:Smed_1100)Predicted SEED Role
"Conserved hypothetical protein probably involved in sulfate reduction"
Sequence Analysis Tools
PaperBLAST (search for papers about homologs of this protein)
Search CDD (the Conserved Domains Database, which includes COG and superfam)
Predict protein localization: PSORTb (Gram-negative bacteria)
Predict transmembrane helices and signal peptides: Phobius
Check the current SEED with FIGfam search
Find homologs in fast.genomics or the ENIGMA genome browser
See Q92Q79 at UniProt or InterPro
Protein Sequence (105 amino acids)
>SMc01054 required for sulfate utilization, putative electron source for sulfite reductase CysI (Sinorhizobium meliloti 1021) MVEKVLTANRLADGISVWLDASGNWVESLQDAFVARHAEAVAALEATGKRSFDENKVVDV NVIDVEEVDGTLRPLRMRERIRAEGPSIPYAPGYSGLAGPKNVAA