Protein Info for SMc01043 in Sinorhizobium meliloti 1021

Annotation: nitrogen assimilation regulatory protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 484 PF00072: Response_reg" amino acids 6 to 114 (109 residues), 87.7 bits, see alignment E=2.5e-28 TIGR01818: nitrogen regulation protein NR(I)" amino acids 6 to 473 (468 residues), 700.9 bits, see alignment E=3.7e-215 PF00158: Sigma54_activat" amino acids 139 to 305 (167 residues), 240.8 bits, see alignment E=2.6e-75 PF14532: Sigma54_activ_2" amino acids 140 to 310 (171 residues), 78.2 bits, see alignment E=3.1e-25 PF07724: AAA_2" amino acids 162 to 288 (127 residues), 28.4 bits, see alignment E=6.4e-10 PF07728: AAA_5" amino acids 163 to 281 (119 residues), 32.5 bits, see alignment E=3.2e-11 PF25601: AAA_lid_14" amino acids 311 to 390 (80 residues), 81.2 bits, see alignment E=1.6e-26 PF02954: HTH_8" amino acids 433 to 472 (40 residues), 49.9 bits, see alignment 8.7e-17

Best Hits

Swiss-Prot: 100% identical to NTRC_RHIME: DNA-binding transcriptional regulator NtrC (ntrC) from Rhizobium meliloti (strain 1021)

KEGG orthology group: K07712, two-component system, NtrC family, nitrogen regulation response regulator GlnG (inferred from 100% identity to sme:SMc01043)

Predicted SEED Role

"Nitrogen regulation protein NtrC"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See P10577 at UniProt or InterPro

Protein Sequence (484 amino acids)

>SMc01043 nitrogen assimilation regulatory protein (Sinorhizobium meliloti 1021)
MTGATILVADDDAAIRTVLNQALSRAGYDVRITSNAATLWRWIAAGDGDLVVTDVVMPDE
NAFDLLPRIKKARPDLPVLVMSAQNTFMTAIKASEKGAYDYLPKPFDLTELIGIIGRALA
EPKRRPSKLEDDSQDGMPLVGRSAAMQEIYRVLARLMQTDLTLMITGESGTGKELVARAL
HDYGKRRNGPFVAINMAAIPRDLIESELFGHEKGAFTGAQTRSTGRFEQAEGGTLFLDEI
GDMPMDAQTRLLRVLQQGEYTTVGGRTPIRSDVRIVAATNKDLKQSINQGLFREDLYYRL
NVVPLRLPPLRDRAEDIPDLVRHFVQQAEKEGLDVKRFDQEALELMKAHPWPGNVRELEN
LVRRLTALYPQDVITREIIENELRSEIPDSPIEKAAARSGSLSISQAVEENMRQYFASFG
DALPPSGLYDRVLAEMEYPLILAALTATRGNQIKAADLLGLNRNTLRKKIRELGVSVYRS
SRSA