Protein Info for SMc01042 in Sinorhizobium meliloti 1021

Annotation: nitrogen regulation protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 382 PF00989: PAS" amino acids 18 to 120 (103 residues), 35.1 bits, see alignment E=1.8e-12 PF00512: HisKA" amino acids 144 to 199 (56 residues), 51.3 bits, see alignment 1.5e-17 PF02518: HATPase_c" amino acids 246 to 364 (119 residues), 66.6 bits, see alignment E=3.9e-22

Best Hits

Swiss-Prot: 100% identical to NTRB_RHIME: Sensory histidine kinase/phosphatase NtrB (ntrB) from Rhizobium meliloti (strain 1021)

KEGG orthology group: K07708, two-component system, NtrC family, nitrogen regulation sensor histidine kinase GlnL [EC: 2.7.13.3] (inferred from 100% identity to sme:SMc01042)

Predicted SEED Role

"Nitrogen regulation protein NtrB (EC 2.7.13.3)" (EC 2.7.13.3)

Isozymes

Compare fitness of predicted isozymes for: 2.7.13.3

Use Curated BLAST to search for 2.7.13.3

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q52977 at UniProt or InterPro

Protein Sequence (382 amino acids)

>SMc01042 nitrogen regulation protein (Sinorhizobium meliloti 1021)
MTEKATAPGEGANDLSMAVLNAIQNPVILVDENGFVAFANWEAESFFGASANHLARHDIS
AFIPFGSPLLTLIEQVRERRAAVNEYRVDLSSPRLGADKLVDLYVAPVLSQPGSVVIVFQ
ERSMADKIDRQLTHRAAARSVTGLASMLAHEIKNPLSGIRGAAQLLETSVNDEDRSLTRL
ICDETDRIVSLVDRMEVFSDERPVDRLPLNIHAVLDHVKAIAKAGFARRIKISEHYDPSL
PPVFANRDQLVQVFLNLIKNAAEAIGDRADGEILLTTAYRPGIRLSVAGTREKISLPLEF
CVHDNGPGVPPDLLPHLFDPFITTKTNGSGLGLALVAKIIGGHGGIVECDSQHSRTTFRV
LMPASKGLAADEETPMTKGTNG