Protein Info for SMc01041 in Sinorhizobium meliloti 1021

Annotation: NIFR3-like protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR00737: putative TIM-barrel protein, nifR3 family
  • amino acids 19 to 311 (293 residues), 331.5 bits, E=2.6e-103
• PF01207: Dus
  • amino acids 30 to 302 (273 residues), 313.4 bits, E=7.6e-98

Best Hits

Swiss-Prot: 76% identical to DUS_RHILP: Probable tRNA-dihydrouridine synthase (dus) from Rhizobium leguminosarum bv. phaseoli

KEGG orthology group: None (inferred from 100% identity to sme:SMc01041)

Predicted SEED Role

"tRNA dihydrouridine synthase B (EC 1.-.-.-)" (EC 1.-.-.-)

KEGG Metabolic Maps

• Alkaloid biosynthesis I
• Carotenoid biosynthesis - General
• Insect hormone biosynthesis
• Nucleotide sugars metabolism
• Porphyrin and chlorophyll metabolism
• Puromycin biosynthesis
• Trinitrotoluene degradation
• alpha-Linolenic acid metabolism

Isozymes

Compare fitness of predicted isozymes for: 1.-.-.-

Use Curated BLAST to search for 1.-.-.-

Sequence Analysis Tools

See Q92Q89 at UniProt or InterPro

Protein Sequence (342 amino acids)

>SMc01041 NIFR3-like protein (Sinorhizobium meliloti 1021)
MCLKDMHLPSTAFSPSLLIGNVEIRNRVALAPMSGVTDLPFRMLAWRFGAGFVVTEMVAS
RELVGNAAESWARLKNSGIDPHIVQLAGREAHWMAEAARIVEANGADIIDINMGCPAKKV
TGGYSGSALMRDPDHALSLIEATVKAATVPVTLKMRLGWDENSINAPLIARRAEEAGVKA
ITIHGRTRMQFYNGKADWDAIGAVREVVSIPLIANGDVDSVADAHEILRRSGADAVMVGR
SCQGRPWHAGVLAGAAAHPDASGVARIFAEHYEMMLEFYGVEVGLRTARKHAGWYLDRFA
PELPASEKAAILTSTDKGFVRDSVVAAIVRSGGAAAREEIAA