Protein Info for SMc01032 in Sinorhizobium meliloti 1021

Annotation: dihydrolipoamide S-acetyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 447 PF00364: Biotin_lipoyl" amino acids 4 to 77 (74 residues), 73.5 bits, see alignment E=1.5e-24 TIGR01349: pyruvate dehydrogenase complex dihydrolipoamide acetyltransferase" amino acids 4 to 447 (444 residues), 634.6 bits, see alignment E=5.1e-195 PF02817: E3_binding" amino acids 141 to 176 (36 residues), 62.8 bits, see alignment 4.1e-21 PF00198: 2-oxoacid_dh" amino acids 216 to 446 (231 residues), 274.3 bits, see alignment E=1.2e-85

Best Hits

Swiss-Prot: 100% identical to ODP2_RHIME: Dihydrolipoyllysine-residue acetyltransferase component of pyruvate dehydrogenase complex (pdhC) from Rhizobium meliloti (strain 1021)

KEGG orthology group: K00627, pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC: 2.3.1.12] (inferred from 100% identity to smk:Sinme_1248)

Predicted SEED Role

"Dihydrolipoamide acetyltransferase component of pyruvate dehydrogenase complex (EC 2.3.1.12)" in subsystem Pyruvate metabolism II: acetyl-CoA, acetogenesis from pyruvate (EC 2.3.1.12)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.3.1.12

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q9R9N3 at UniProt or InterPro

Protein Sequence (447 amino acids)

>SMc01032 dihydrolipoamide S-acetyltransferase (Sinorhizobium meliloti 1021)
MPINITMPALSPTMEEGNLAKWLVKEGDKVKSGDVIAEIETDKATMEVEAVDEGTVAKIV
VPAGTEGVKVNALIAVLAAEGEDVATAAKGGNGAAGAVPAPKPKETAETAPAAAPAPAAA
PAPQAAAPASPAPADGEGKRIFSSPLARRLAKEAGIDLSAIAGSGPHGRVVKKDVETAVS
GGAAKPAGAPAAAPAPATLAKGMSEDAVLKLFEPGSYELVPHDGMRKTIAKRLVESKQTI
PHFYVSVDCELDALMALRAQLNAAAPEKDGKPVYKLSVNDMVIKALALALRDVPDANVSW
TDQNMVKHKHADVGVAVSIPGGLITPIVRQAELKSLSAISNEMKDLGKRAKERKLKPEEY
QGGTTAVSNMGMMGVKDFAAVVNPPHATILAVGAGEDRVVVRNKEMVIANVMTVTLSTDH
RCVDGALGAELLAAFKRYIENPMGMLV