Protein Info for SMc01032 in Sinorhizobium meliloti 1021

Annotation: dihydrolipoamide S-acetyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00364: Biotin_lipoyl
  • amino acids 4 to 77 (74 residues), 73.5 bits, E=1.9e-24
• TIGR01349: pyruvate dehydrogenase complex dihydrolipoamide acetyltransferase
  • amino acids 4 to 447 (444 residues), 634.6 bits, E=5.1e-195
• PF13533: Biotin_lipoyl_2
  • amino acids 17 to 48 (32 residues), 27.1 bits, see alignment (E = 5.7e-10)
• PF02817: E3_binding
  • amino acids 141 to 176 (36 residues), 62.6 bits, 6.5e-21
• PF00198: 2-oxoacid_dh
  • amino acids 216 to 446 (231 residues), 275.4 bits, E=7.3e-86

Best Hits

Swiss-Prot: 100% identical to ODP2_RHIME: Dihydrolipoyllysine-residue acetyltransferase component of pyruvate dehydrogenase complex (pdhC) from Rhizobium meliloti (strain 1021)

KEGG orthology group: K00627, pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC: 2.3.1.12] (inferred from 100% identity to smk:Sinme_1248)

Predicted SEED Role

"Dihydrolipoamide acetyltransferase component of pyruvate dehydrogenase complex (EC 2.3.1.12)" in subsystem Pyruvate metabolism II: acetyl-CoA, acetogenesis from pyruvate (EC 2.3.1.12)

MetaCyc Pathways

• photosynthetic 3-hydroxybutanoate biosynthesis (engineered) (22/26 steps found)
• superpathway of glycolysis, pyruvate dehydrogenase, TCA, and glyoxylate bypass (22/26 steps found)
• superpathway of cytosolic glycolysis (plants), pyruvate dehydrogenase and TCA cycle (19/22 steps found)
• 1-butanol autotrophic biosynthesis (engineered) (21/27 steps found)
• pyruvate decarboxylation to acetyl CoA I (3/3 steps found)
• pyruvate fermentation to acetate II (3/3 steps found)
• pyruvate fermentation to acetate and (S)-lactate I (3/4 steps found)
• pyruvate fermentation to acetate V (2/3 steps found)
• anaerobic energy metabolism (invertebrates, mitochondrial) (7/10 steps found)
• superpathway of anaerobic energy metabolism (invertebrates) (12/17 steps found)

KEGG Metabolic Maps

• Biosynthesis of alkaloids derived from histidine and purine
• Biosynthesis of alkaloids derived from ornithine, lysine and nicotinic acid
• Biosynthesis of alkaloids derived from shikimate pathway
• Biosynthesis of alkaloids derived from terpenoid and polyketide
• Biosynthesis of phenylpropanoids
• Biosynthesis of plant hormones
• Biosynthesis of terpenoids and steroids
• Citrate cycle (TCA cycle)
• Glycolysis / Gluconeogenesis
• Pyruvate metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.3.1.12

Sequence Analysis Tools

See Q9R9N3 at UniProt or InterPro

Protein Sequence (447 amino acids)

>SMc01032 dihydrolipoamide S-acetyltransferase (Sinorhizobium meliloti 1021)
MPINITMPALSPTMEEGNLAKWLVKEGDKVKSGDVIAEIETDKATMEVEAVDEGTVAKIV
VPAGTEGVKVNALIAVLAAEGEDVATAAKGGNGAAGAVPAPKPKETAETAPAAAPAPAAA
PAPQAAAPASPAPADGEGKRIFSSPLARRLAKEAGIDLSAIAGSGPHGRVVKKDVETAVS
GGAAKPAGAPAAAPAPATLAKGMSEDAVLKLFEPGSYELVPHDGMRKTIAKRLVESKQTI
PHFYVSVDCELDALMALRAQLNAAAPEKDGKPVYKLSVNDMVIKALALALRDVPDANVSW
TDQNMVKHKHADVGVAVSIPGGLITPIVRQAELKSLSAISNEMKDLGKRAKERKLKPEEY
QGGTTAVSNMGMMGVKDFAAVVNPPHATILAVGAGEDRVVVRNKEMVIANVMTVTLSTDH
RCVDGALGAELLAAFKRYIENPMGMLV