Protein Info for SMc01031 in Sinorhizobium meliloti 1021

Annotation: pyruvate dehydrogenase subunit beta

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 460 PF00364: Biotin_lipoyl" amino acids 4 to 77 (74 residues), 67 bits, see alignment E=1.6e-22 PF02779: Transket_pyr" amino acids 137 to 312 (176 residues), 161.7 bits, see alignment E=2.1e-51 PF02780: Transketolase_C" amino acids 328 to 450 (123 residues), 140.9 bits, see alignment E=3.1e-45

Best Hits

Swiss-Prot: 100% identical to ODPB_RHIME: Pyruvate dehydrogenase E1 component subunit beta (pdhB) from Rhizobium meliloti (strain 1021)

KEGG orthology group: K00162, pyruvate dehydrogenase E1 component subunit beta [EC: 1.2.4.1] (inferred from 100% identity to smk:Sinme_1247)

Predicted SEED Role

"Pyruvate dehydrogenase E1 component beta subunit (EC 1.2.4.1)" in subsystem Pyruvate metabolism II: acetyl-CoA, acetogenesis from pyruvate (EC 1.2.4.1)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.2.4.1

Use Curated BLAST to search for 1.2.4.1

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q9R9N4 at UniProt or InterPro

Protein Sequence (460 amino acids)

>SMc01031 pyruvate dehydrogenase subunit beta (Sinorhizobium meliloti 1021)
MPVEILMPALSPTMEEGTLSKWLKNEGDKVSSGDVIAEIETDKATMEVEAVDEGTIGKLL
IAAGTEGVKVNTPIAVLLQDGEAASDIDSMKTEAPKAETPKPAAAEAPAASAAPVAAQPK
ADVPSDPAIPAGTEMATMTVREALRDAMAEEMRANEDVFVMGEEVAEYQGAYKVTQGLLQ
EFGARRVVDTPITEHGFAGVGVGAAMTGLRPIVEFMTFNFAMQAIDQIINSAAKTLYMSG
GQMGAPIVFRGPSGAAARVAAQHSQCYAAWYSHIPGLKVVMPYTAADAKGLLKAAIRDPN
PVIFLENEILYGQSFEVPKLDDFVLPIGKARIHRTGKDATLVSFGIGMTYAIKAAAELEA
QGIDVEIIDLRTIRPMDLPTVIESVKKTGRLVTVEEGYPQSSVGTEIATRVMQQAFDYLD
APILTIAGKDVPMPYAANLEKLALPNVAEVVDAVKAVCYK