Protein Info for SMc01030 in Sinorhizobium meliloti 1021

Annotation: pyruvate dehydrogenase alpha2 subunit protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR03182: pyruvate dehydrogenase (acetyl-transferring) E1 component, alpha subunit
  • amino acids 34 to 347 (314 residues), 524 bits, E=5.2e-162
• PF00676: E1_dh
  • amino acids 42 to 339 (298 residues), 372.8 bits, E=1.6e-115
• PF02775: TPP_enzyme_C
  • amino acids 133 to 262 (130 residues), 22.3 bits, E=1.5e-08
• PF13292: DXP_synthase_N
  • amino acids 133 to 211 (79 residues), 30.1 bits, E=4.7e-11

Best Hits

Swiss-Prot: 100% identical to ODPA_RHIME: Pyruvate dehydrogenase E1 component subunit alpha (pdhA) from Rhizobium meliloti (strain 1021)

KEGG orthology group: K00161, pyruvate dehydrogenase E1 component subunit alpha [EC: 1.2.4.1] (inferred from 100% identity to smk:Sinme_1246)

MetaCyc: 47% identical to pyruvate dehydrogenase complex E1 component alpha subunit (Synechococcus elongatus PCC 7942 = FACHB-805)

Predicted SEED Role

"Pyruvate dehydrogenase E1 component alpha subunit (EC 1.2.4.1)" in subsystem Pyruvate metabolism II: acetyl-CoA, acetogenesis from pyruvate (EC 1.2.4.1)

MetaCyc Pathways

• photosynthetic 3-hydroxybutanoate biosynthesis (engineered) (22/26 steps found)
• superpathway of glycolysis, pyruvate dehydrogenase, TCA, and glyoxylate bypass (22/26 steps found)
• superpathway of cytosolic glycolysis (plants), pyruvate dehydrogenase and TCA cycle (19/22 steps found)
• superpathway of glyoxylate bypass and TCA (11/12 steps found)
• TCA cycle I (prokaryotic) (9/10 steps found)
• TCA cycle III (animals) (9/10 steps found)
• TCA cycle VIII (Chlamydia) (6/6 steps found)
• 1-butanol autotrophic biosynthesis (engineered) (21/27 steps found)
• TCA cycle II (plants and fungi) (8/9 steps found)
• pyruvate decarboxylation to acetyl CoA I (3/3 steps found)
• pyruvate fermentation to acetate II (3/3 steps found)
• pyruvate fermentation to acetate and (S)-lactate I (3/4 steps found)
• pyruvate fermentation to acetate V (2/3 steps found)
• anaerobic energy metabolism (invertebrates, mitochondrial) (7/10 steps found)
• superpathway of anaerobic energy metabolism (invertebrates) (12/17 steps found)

KEGG Metabolic Maps

• Biosynthesis of alkaloids derived from histidine and purine
• Biosynthesis of alkaloids derived from ornithine, lysine and nicotinic acid
• Biosynthesis of alkaloids derived from shikimate pathway
• Biosynthesis of alkaloids derived from terpenoid and polyketide
• Biosynthesis of phenylpropanoids
• Biosynthesis of plant hormones
• Biosynthesis of terpenoids and steroids
• Butanoate metabolism
• Citrate cycle (TCA cycle)
• Glycolysis / Gluconeogenesis
• Pyruvate metabolism
• Valine, leucine and isoleucine biosynthesis

Isozymes

Compare fitness of predicted isozymes for: 1.2.4.1

Use Curated BLAST to search for 1.2.4.1

Sequence Analysis Tools

See Q9R9N5 at UniProt or InterPro

Protein Sequence (348 amino acids)

>SMc01030 pyruvate dehydrogenase alpha2 subunit protein (Sinorhizobium meliloti 1021)
MAPRKSASVSSRKTAAKPAKKDFAGGTIAEFSKEDDLKAYREMLLIRRFEEKAGQLYGMG
FIGGFCHLYIGQEAVVVGMQLALKEGDQVITGYRDHGHMLACGMSARGVMAELTGRRGGL
SKGKGGSMHMFSKEKHFYGGHGIVGAQVSLGTGLAFANRYRGNDNVSLAYFGDGAANQGQ
VYESFNMAALWKLPVIYIVENNRYAMGTSVSRASAQTDFSQRGASFGIPGYQVDGMDVRA
VKAAADEAVEHCRSGKGPIILEMLTYRYRGHSMSDPAKYRSKDEVQKMRSEHDPIEQVKA
RLTDKGWATEDELKQIDKEVRDIVADSADFAQSDPEPDVSELYTDILL