Protein Info for SMc01023 in Sinorhizobium meliloti 1021

Annotation: triosephosphate isomerase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00121: TIM
  • amino acids 7 to 250 (244 residues), 286.7 bits, E=8.1e-90
• TIGR00419: triose-phosphate isomerase
  • amino acids 8 to 242 (235 residues), 168.4 bits, E=1.1e-53

Best Hits

Swiss-Prot: 100% identical to TPIS_RHIME: Triosephosphate isomerase (tpiA) from Rhizobium meliloti (strain 1021)

KEGG orthology group: K01803, triosephosphate isomerase (TIM) [EC: 5.3.1.1] (inferred from 99% identity to smk:Sinme_1238)

MetaCyc: 40% identical to triosephosphate isomerase subunit (Lactococcus lactis)
Triose-phosphate isomerase. [EC: 5.3.1.1]

Predicted SEED Role

"Triosephosphate isomerase (EC 5.3.1.1)" in subsystem Calvin-Benson cycle or Glycolysis and Gluconeogenesis or Glycolysis and Gluconeogenesis, including Archaeal enzymes or MLST (EC 5.3.1.1)

MetaCyc Pathways

• photosynthetic 3-hydroxybutanoate biosynthesis (engineered) (22/26 steps found)
• superpathway of glycolysis, pyruvate dehydrogenase, TCA, and glyoxylate bypass (22/26 steps found)
• superpathway of cytosolic glycolysis (plants), pyruvate dehydrogenase and TCA cycle (19/22 steps found)
• Calvin-Benson-Bassham cycle (12/13 steps found)
• gluconeogenesis I (12/13 steps found)
• formaldehyde assimilation III (dihydroxyacetone cycle) (11/12 steps found)
• glycolysis III (from glucose) (10/11 steps found)
• superpathway of glycolysis and the Entner-Doudoroff pathway (14/17 steps found)
• 1-butanol autotrophic biosynthesis (engineered) (21/27 steps found)
• homolactic fermentation (10/12 steps found)
• glycolysis II (from fructose 6-phosphate) (9/11 steps found)
• ethene biosynthesis V (engineered) (19/25 steps found)
• glycolysis IV (8/10 steps found)
• oxygenic photosynthesis (13/17 steps found)
• glycolysis I (from glucose 6-phosphate) (10/13 steps found)
• glycerol degradation to butanol (12/16 steps found)
• gluconeogenesis III (9/12 steps found)
• superpathway of anaerobic sucrose degradation (14/19 steps found)
• superpathway of N-acetylneuraminate degradation (16/22 steps found)
• superpathway of hexitol degradation (bacteria) (13/18 steps found)
• glycolysis VI (from fructose) (7/11 steps found)
• glycolysis V (Pyrococcus) (6/10 steps found)
• sucrose degradation V (sucrose α-glucosidase) (2/5 steps found)
• hexitol fermentation to lactate, formate, ethanol and acetate (12/19 steps found)
• gluconeogenesis II (Methanobacterium thermoautotrophicum) (7/18 steps found)
• Methanobacterium thermoautotrophicum biosynthetic metabolism (20/56 steps found)

KEGG Metabolic Maps

• Carbon fixation in photosynthetic organisms
• Fructose and mannose metabolism
• Glycolysis / Gluconeogenesis
• Inositol phosphate metabolism

Isozymes

Compare fitness of predicted isozymes for: 5.3.1.1

Use Curated BLAST to search for 5.3.1.1

Sequence Analysis Tools

See Q92QA1 at UniProt or InterPro

Protein Sequence (256 amino acids)

>SMc01023 triosephosphate isomerase (Sinorhizobium meliloti 1021)
MTPDIRPLVAGNWKMNGTRASLDQIKAMAEGVKGDLSARVDALICPPATLLYVATALCDD
SPLMIGAQDCHQKQSGAHTGEVSAEMVADCFGTHVIVGHSERRTDHGEGDALVRAKTEAA
HGADLVAIVCVGETEEERKAGRTLDILKRQLSESLPDQATAENTVIAYEPVWAIGTGLTP
TVSDVEEAHAFMRRELVSRFGAEGGKMRILYGGSVKPSNAKELMGVANVDGALIGGASLK
ADDFLAIYRAYEELTA