Protein Info for SMc01007 in Sinorhizobium meliloti 1021

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 124 PF01809: YidD" amino acids 38 to 100 (63 residues), 83.1 bits, see alignment E=4.7e-28 TIGR00278: putative membrane protein insertion efficiency factor" amino acids 39 to 103 (65 residues), 78.2 bits, see alignment E=1.7e-26

Best Hits

Swiss-Prot: 100% identical to YIDD_RHIME: Putative membrane protein insertion efficiency factor (R01422) from Rhizobium meliloti (strain 1021)

KEGG orthology group: K08998, hypothetical protein (inferred from 100% identity to sme:SMc01007)

Predicted SEED Role

"Protein YidD"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q92QB2 at UniProt or InterPro

Protein Sequence (124 amino acids)

>SMc01007 hypothetical protein (Sinorhizobium meliloti 1021)
MCPQPHADHAITRGDTGAAGGRNWSGPFRKTPGRLVGMTLIRAYQLTLSSFIGNSCRHLP
TCSEYGFEAIARYGLWAGGWLTLFRVVRCGPGGTHGFDPVPDSLAPRQRWYTPWRYWQPR
RKDA