Protein Info for SMc00981 in Sinorhizobium meliloti 1021

Annotation: ferredoxin protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 364 PF00970: FAD_binding_6" amino acids 32 to 119 (88 residues), 41.9 bits, see alignment E=2.1e-14 PF00175: NAD_binding_1" amino acids 130 to 236 (107 residues), 55.8 bits, see alignment E=1.3e-18 PF13510: Fer2_4" amino acids 280 to 316 (37 residues), 23.2 bits, see alignment 1.2e-08 PF00111: Fer2" amino acids 287 to 357 (71 residues), 55.9 bits, see alignment E=6.5e-19

Best Hits

KEGG orthology group: None (inferred from 100% identity to smk:Sinme_0578)

Predicted SEED Role

"Flavodoxin reductases (ferredoxin-NADPH reductases) family 1" in subsystem Anaerobic respiratory reductases

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q92RJ9 at UniProt or InterPro

Protein Sequence (364 amino acids)

>SMc00981 ferredoxin protein (Sinorhizobium meliloti 1021)
MEMPRSFRHFDELDPWRDRQHMLECMSAVAETADVMTFTFRSDKPAWFRYLPGQFVTLEL
PVAAKPVMRTYTLSSSPSRPLSVAVTVKAQPGSIGTRWMFDNLKPGMMLKAFGPLGDFSF
VRHPGEKYLFISAGSGVTPMMSMTRWMADCAPETDVTFISCARRPDDLLFRSELEVLARQ
MPGLNLGFLVEGHEARHGWHGLRGRIDAAKLPMLAPDFLERTVFCCGPEPFMGNVRAMLE
AAGFDMARYHQESFQPAAAPAAEELAIRAGPTADAGAGAARVTFTMSGKEATAVPGQTIL
QTARANGVRIGAACEGGICGTCRVLKIAGDVEMNHNGGILDDEIEEGYILACCSRPTSDV
QIEA