Protein Info for SMc00974 in Sinorhizobium meliloti 1021

Annotation: RNA methyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 415 PF01938: TRAM" amino acids 3 to 45 (43 residues), 23.2 bits, see alignment 1.3e-08 PF05175: MTS" amino acids 246 to 354 (109 residues), 25 bits, see alignment E=3.3e-09 PF03602: Cons_hypoth95" amino acids 252 to 361 (110 residues), 28 bits, see alignment E=4.2e-10 PF02475: Met_10" amino acids 266 to 313 (48 residues), 22.7 bits, see alignment 2e-08 PF05958: tRNA_U5-meth_tr" amino acids 276 to 415 (140 residues), 44.1 bits, see alignment E=3.6e-15

Best Hits

Swiss-Prot: 100% identical to Y878_RHIME: Uncharacterized RNA methyltransferase R00878 (R00878) from Rhizobium meliloti (strain 1021)

KEGG orthology group: K03215, RNA methyltransferase, TrmA family [EC: 2.1.1.-] (inferred from 100% identity to smk:Sinme_0585)

Predicted SEED Role

"macromolecule metabolism; macromolecule synthesis, modification; rna synthesis, modification , dna transcription"

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.1.1.-

Use Curated BLAST to search for 2.1.1.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q92RJ3 at UniProt or InterPro

Protein Sequence (415 amino acids)

>SMc00974 RNA methyltransferase (Sinorhizobium meliloti 1021)
MSTGTVTIDRLGAQGDGVARTEAGPVFAPFTLPGETVSLAVNKANGTLISLKEASPERVE
PPCRHFGPDGVNGTCGGCTLQHASDALYHAFKRNLVIDALRSKGLTPEVGALIIARPGDR
RRAAFTARRTEKELLLGYNQMQSHHIVSIGECPITSPGIVSRLATIRKIAAAMASSAEPF
RITVLETDTGLDLAFEGLKLSDPQRRSAVDAVLGERGIARVSLNGEIVVEPLKPAIDFDG
VTVSPPPGAFTQATRPAEDAMAKLVLAHVGKAKRVADLFAGIGTFALRIARTARVHAVEG
DDRAVKALDFAARNTQGLKPVTAEKRDLFRRPMMAQELKAFDAVVFDPPRAGAETQCHEL
ARSGVKKIAAVSCNPVTLARDLSILTAAGYRITGVTPIDQFLWSAHVETVATLEK