Protein Info for SMc00972 in Sinorhizobium meliloti 1021

Annotation: 1-deoxy-D-xylulose-5-phosphate synthase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF13292: DXP_synthase_N
  • amino acids 15 to 288 (274 residues), 391.4 bits, E=6.2e-121
• TIGR00204: 1-deoxy-D-xylulose-5-phosphate synthase
  • amino acids 17 to 633 (617 residues), 795.7 bits, E=1.5e-243
• PF00676: E1_dh
  • amino acids 127 to 212 (86 residues), 32.3 bits, E=1.6e-11
• PF02779: Transket_pyr
  • amino acids 325 to 486 (162 residues), 153.9 bits, E=1.1e-48
• PF02780: Transketolase_C
  • amino acids 502 to 625 (124 residues), 98 bits, E=1.2e-31

Best Hits

Swiss-Prot: 100% identical to DXS_RHIME: 1-deoxy-D-xylulose-5-phosphate synthase (dxs) from Rhizobium meliloti (strain 1021)

KEGG orthology group: K01662, 1-deoxy-D-xylulose-5-phosphate synthase [EC: 2.2.1.7] (inferred from 100% identity to smk:Sinme_0587)

MetaCyc: 57% identical to 1-deoxy-D-xylulose 5-phosphate synthase (Arabidopsis thaliana col)
1-deoxy-D-xylulose-5-phosphate synthase. [EC: 2.2.1.7]

Predicted SEED Role

"1-deoxy-D-xylulose 5-phosphate synthase (EC 2.2.1.7)" in subsystem Isoprenoid Biosynthesis or Pyridoxin (Vitamin B6) Biosynthesis or Thiamin biosynthesis (EC 2.2.1.7)

MetaCyc Pathways

• methylerythritol phosphate pathway II (8/9 steps found)
• superpathway of pyridoxal 5'-phosphate biosynthesis and salvage (10/12 steps found)
• pyridoxal 5'-phosphate biosynthesis I (6/7 steps found)
• superpathway of geranylgeranyl diphosphate biosynthesis II (via MEP) (8/12 steps found)
• superpathway of thiamine diphosphate biosynthesis II (7/11 steps found)
• thiazole component of thiamine diphosphate biosynthesis II (4/7 steps found)
• taxadiene biosynthesis (engineered) (8/13 steps found)
• methylerythritol phosphate pathway I (5/9 steps found)
• isoprene biosynthesis I (5/10 steps found)
• superpathway of thiamine diphosphate biosynthesis I (5/10 steps found)
• thiazole component of thiamine diphosphate biosynthesis I (2/6 steps found)
• superpathway of ergosterol biosynthesis II (7/26 steps found)

KEGG Metabolic Maps

• Biosynthesis of alkaloids derived from terpenoid and polyketide
• Biosynthesis of plant hormones
• Biosynthesis of terpenoids and steroids
• Terpenoid biosynthesis

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.2.1.7

Sequence Analysis Tools

See Q92RJ1 at UniProt or InterPro

Protein Sequence (645 amino acids)

>SMc00972 1-deoxy-D-xylulose-5-phosphate synthase (Sinorhizobium meliloti 1021)
MTQLPTNPMPATPLLDKVDYPDDLKKIDDRDLPQLAAELRAEMVDAVSRTGGHLGAGLGV
VELTIAIHKIFDTPHDRLIFDVGHQCYPHKILTGRRDRIRTLRQEDGLSGFTRRAESEYD
PFGAAHSSTSISAGLGMAVAAELDGKSRNVIAVIGDGAMSAGMAFEALNNAGALDARLIV
ILNDNDMSIAPPTGAMSAYLARLASGRTYMGIREVGKKLTAYLGKTVDRAITRAVEHARG
YVTGGTLFEEMGFYHIGPIDGHSFDHLLPVLRNVRDNAKGPVLIHVVTQKGKGYPPAEAA
ADKYHGVNKFDVITGAQAKAKPNAPAYTSVFADALTQEASLDDKIVAITAAMPSGTGLDK
FASVHPSRCFDVGIAEQHAVTFAAGLAAEGYKPFAALYSTFLQRAYDQVVHDVAIQGLPV
RFPIDRAGFVGADGPTHAGSFDTTYLATLPGFVVMAAADEAELKHMVRTAAAYDEGPISF
RYPRGEGVGVELPERGEILAIGKGRIVKQGNKVALLSFGTRLADCLLAAEDLDAAGLSTT
VADARFAKPLDHDLIRQLARHHEVLITIEEGAVGGFASHVLQFLAEEGLIDGGLKVRPMV
MPDIWMEQAKPEAMYARAGLDRAGIVSTVFKALGQKHGVGLGAAG