Protein Info for SMc00970 in Sinorhizobium meliloti 1021

Annotation: exodeoxyribonuclease VII small subunit

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR01280: exodeoxyribonuclease VII, small subunit
  • amino acids 13 to 67 (55 residues), 77.3 bits, E=3.6e-26
• PF02609: Exonuc_VII_S
  • amino acids 14 to 65 (52 residues), 68.2 bits, E=2.6e-23

Best Hits

Swiss-Prot: 100% identical to EX7S_RHIME: Exodeoxyribonuclease 7 small subunit (xseB) from Rhizobium meliloti (strain 1021)

KEGG orthology group: K03602, exodeoxyribonuclease VII small subunit [EC: 3.1.11.6] (inferred from 100% identity to smk:Sinme_0589)

Predicted SEED Role

"Exodeoxyribonuclease VII small subunit (EC 3.1.11.6)" in subsystem DNA repair, bacterial (EC 3.1.11.6)

Isozymes

Compare fitness of predicted isozymes for: 3.1.11.6

Use Curated BLAST to search for 3.1.11.6

Sequence Analysis Tools

See Q92RI9 at UniProt or InterPro

Protein Sequence (83 amino acids)

>SMc00970 exodeoxyribonuclease VII small subunit (Sinorhizobium meliloti 1021)
MNNNAQPDVSALSFEQAVEELERIVSALERGDVALDKSIEIYERGEALKKHCEALLKAAE
DRIEKIRLDRAGRPQGVEPLDAE