Protein Info for SMc00968 in Sinorhizobium meliloti 1021

Annotation: oxidoreductase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 322 PF08240: ADH_N" amino acids 28 to 110 (83 residues), 55.4 bits, see alignment E=6.8e-19 PF13602: ADH_zinc_N_2" amino acids 200 to 318 (119 residues), 45.5 bits, see alignment E=1.5e-15

Best Hits

KEGG orthology group: None (inferred from 100% identity to sme:SMc00968)

Predicted SEED Role

"Putative oxidoreductase SMc00968"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q92RI7 at UniProt or InterPro

Protein Sequence (322 amino acids)

>SMc00968 oxidoreductase (Sinorhizobium meliloti 1021)
MRSTLVRQFGDPGQVIELVDAPRPAPGTGEVEVEISLAAINPSDLIPVTGAYSARTALPF
VPGFEGVGIVRRVGPDVQGFKAGDRVVPIGASGLWQQFLLRPAEWCFHVPGGIEDAQAAM
SYVNPLTALTLAEALREHFGSLEGMDVGVTAAGSAIGGMLMKLLALEGAVPTAMLRSDRS
RGRLGETHRILVADSGDGLMGSQFDAVLDAVGGTLAGELIGRSIRPGGTFIQYGALSGAP
VPQTAISGRPDIRFAFLWLRTWVHSAGREALEAAFLRSFAGLQSGLFASPIAATYPLSRL
ADALAHQADPRRDGKILLDPRC