Protein Info for SMc00963 in Sinorhizobium meliloti 1021

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 201 transmembrane" amino acids 22 to 53 (32 residues), see Phobius details amino acids 65 to 84 (20 residues), see Phobius details amino acids 92 to 116 (25 residues), see Phobius details amino acids 129 to 148 (20 residues), see Phobius details amino acids 175 to 190 (16 residues), see Phobius details PF02361: CbiQ" amino acids 10 to 199 (190 residues), 37.9 bits, see alignment E=7.6e-14

Best Hits

Swiss-Prot: 55% identical to BION_RHIEC: Energy-coupling factor transporter transmembrane protein BioN (bioN) from Rhizobium etli (strain CFN 42 / ATCC 51251)

KEGG orthology group: K02008, cobalt/nickel transport system permease protein (inferred from 100% identity to sme:SMc00963)

Predicted SEED Role

"Transmembrane component BioN of energizing module of biotin ECF transporter" in subsystem Biotin biosynthesis or ECF class transporters

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q92RI2 at UniProt or InterPro

Protein Sequence (201 amino acids)

>SMc00963 hypothetical protein (Sinorhizobium meliloti 1021)
MLTSLYVEGASWFHRVPVRAKLVALAVLSIALFATDSPFLLLPAFLLSGWLYLSLGLRPR
EALSRVGFVFFTILILAAVNLFLVPVPQVAALVLRLMALVLFAAAVTATTTIGAFMDEIT
IILKPLERLGLLRAADVGLALGLVLRFVPDIFTRYQALAEAHRARGLPVRPLTIIGPLII
LTLKDADTIAAAIDARGFRRQ