Protein Info for SMc00932 in Sinorhizobium meliloti 1021

Annotation: DNA mismatch repair protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 605 TIGR00585: DNA mismatch repair protein MutL" amino acids 1 to 305 (305 residues), 298 bits, see alignment E=5.6e-93 PF02518: HATPase_c" amino acids 23 to 77 (55 residues), 28.5 bits, see alignment 3.6e-10 PF13589: HATPase_c_3" amino acids 24 to 117 (94 residues), 41.9 bits, see alignment E=2.1e-14 PF01119: DNA_mis_repair" amino acids 208 to 324 (117 residues), 129.1 bits, see alignment E=1.3e-41 PF08676: MutL_C" amino acids 421 to 562 (142 residues), 161.9 bits, see alignment E=1.6e-51

Best Hits

Swiss-Prot: 100% identical to MUTL_RHIME: DNA mismatch repair protein MutL (mutL) from Rhizobium meliloti (strain 1021)

KEGG orthology group: K03572, DNA mismatch repair protein MutL (inferred from 100% identity to sme:SMc00932)

Predicted SEED Role

"DNA mismatch repair protein MutL" in subsystem DNA repair, bacterial MutL-MutS system

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q92RP4 at UniProt or InterPro

Protein Sequence (605 amino acids)

>SMc00932 DNA mismatch repair protein (Sinorhizobium meliloti 1021)
MAIKQLSETLINQIAAGEVIERPASAAKELIENALDAGATRIEIATAGGGKTLLRVTDNG
IGMSPADLELAIRRHCTSKLNDSLADIRTLGFRGEALPSIGSVARLSITTRTAEAREGAA
ITVTGGRSEPARPSAAIVGTVVEVRDLFFATPARLKFMKSEKAEAAAISEVVRRMAIAFP
RVRFVLSGSDRTTLEFPATGDDRLARMAQVLGRDFRDNAIEIDAEREGARLTGFAGVPTF
NRGNSLQQYAFVNGRPVQDKLIMSALRAAYAETIPQGRYPIAVLSITLDPALVDVNVHPA
KSDVRFRDPGLIRGLIIGAIREALTREGDRAATTGAHGLMRAFRPEFHRAGQQRPQEPWS
AAASPHRPLRFEEAARGFAEAPQAAFSDFAQPSARSAAAAVEATRATDGQAASFPLGAAR
AQLHENYIVAQTDDGLVIVDQHAAHERLVFETMRTALHARPVPAQALLIPEIVGLPEDDC
DRLMAHAEEFTRLGLAIERFGPAAVAVRETPAMLGEMDAAGLVRQLADELAEWDTASGLA
GRLEYLAATMACHGSVRSGRRLRTEEMNALLRQMEATPGSGQCNHGRPTYIELKLADIER
LFGRS