Protein Info for SMc00919 in Sinorhizobium meliloti 1021

Annotation: histidyl-tRNA synthetase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 504 TIGR00442: histidine--tRNA ligase" amino acids 15 to 459 (445 residues), 388.5 bits, see alignment E=1.9e-120 PF13393: tRNA-synt_His" amino acids 18 to 363 (346 residues), 151 bits, see alignment E=9.5e-48 PF00587: tRNA-synt_2b" amino acids 78 to 364 (287 residues), 31.4 bits, see alignment E=4e-11 PF03129: HGTP_anticodon" amino acids 382 to 468 (87 residues), 41 bits, see alignment E=3.6e-14

Best Hits

Swiss-Prot: 100% identical to SYH_RHIME: Histidine--tRNA ligase (hisS) from Rhizobium meliloti (strain 1021)

KEGG orthology group: K01892, histidyl-tRNA synthetase [EC: 6.1.1.21] (inferred from 100% identity to sme:SMc00919)

Predicted SEED Role

"Histidyl-tRNA synthetase (EC 6.1.1.21)" (EC 6.1.1.21)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 6.1.1.21

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q92RR7 at UniProt or InterPro

Protein Sequence (504 amino acids)

>SMc00919 histidyl-tRNA synthetase (Sinorhizobium meliloti 1021)
MNEKQKKTQKLRARLPRGFVDRSAADIRAVDEMIAKIREVYERYGFDPVETPLFEYTDAL
GKFLPDSDRPNEGVFSLTDDDDQWLSLRYDLTAPLARHVAENFNEIQLPYRTYRAGYVFR
NEKPGPGRFRQFMQFDADTVGAAGVQADAEMCMMMADTMEALGIARGDYVIRVNNRKVLD
GVLEAIGLGGVEQTNTRLTVLRAIDKLDKFGPEGVRLLLGEGRKDESGDFTKGAGLNEEQ
IGKILFFVGITDYARSADELAALVAGTARGAEGVNELNTIRGLVLSAGYEADRIKIDPSV
VRGLEYYTGPVFEAELQFAVTNEKGEKVVFGSVGGGGRYDGLVSRFMGQPVPATGFSIGV
SRLMTALKNLGKLGAEQVTAPVVVCVMDRDIESMGRYQRFVQDLRHAGIRAEMYQGNKKN
FGDQLKYADRRGSPIAVIQGGDERASGVVQIKDLIEGKRLSGEIEDNVAWREARVAQVSV
PEGELVAKVRQILAEQAEDRKRAG