Protein Info for SMc00917 in Sinorhizobium meliloti 1021

Updated annotation (from data): ATP phosphoribosyltransferase (EC 2.4.2.17)
Rationale: Important for fitness in most defined media. Semi-automated annotation based on the auxotrophic phenotype and a hit to HMM TIGR00070.
Original annotation: ATP phosphoribosyltransferase catalytic subunit

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

Best Hits

Swiss-Prot: 100% identical to HIS1_RHIME: ATP phosphoribosyltransferase (hisG) from Rhizobium meliloti (strain 1021)

KEGG orthology group: K00765, ATP phosphoribosyltransferase [EC: 2.4.2.17] (inferred from 100% identity to smk:Sinme_0498)

Predicted SEED Role

"ATP phosphoribosyltransferase (EC 2.4.2.17)" in subsystem Histidine Biosynthesis (EC 2.4.2.17)

MetaCyc Pathways

superpathway of histidine, purine, and pyrimidine biosynthesis (42/46 steps found)
L-histidine biosynthesis (10/10 steps found)

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.4.2.17

Use Curated BLAST to search for 2.4.2.17

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q92RR6 at UniProt or InterPro

Protein Sequence (231 amino acids)

>SMc00917 ATP phosphoribosyltransferase (EC 2.4.2.17) (Sinorhizobium meliloti 1021)
MTVTIALPSKGRMKDEASAIFERAGMKIAAVGSDRSYRGRVEGWDDVEIAYLSASEIARE
IGSGAVDFGVTGEDLVREGLADADARVDFAARLGFGHADVVVAVPEIWYDVDTMADLGDV
AADFRARHGRRLAIATKYWRLTQQFFSGSHGIQLYRIVESLGATEGAPASGSADIIVDIT
STGSTLKANHLKILSDGVILRSEACLVRARKATHEGNPVIDRIVAAVRAVL