Protein Info for SMc00914 in Sinorhizobium meliloti 1021

Annotation: oxidoreductase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 405 signal peptide" amino acids 1 to 24 (24 residues), see Phobius details PF07992: Pyr_redox_2" amino acids 4 to 301 (298 residues), 215.2 bits, see alignment E=4.2e-67 PF01262: AlaDh_PNT_C" amino acids 147 to 196 (50 residues), 24.2 bits, see alignment 6.1e-09 PF00070: Pyr_redox" amino acids 147 to 226 (80 residues), 60.6 bits, see alignment E=5.1e-20 PF14759: Reductase_C" amino acids 320 to 404 (85 residues), 103.6 bits, see alignment E=2e-33

Best Hits

Swiss-Prot: 46% identical to CNDC1_SPHSD: Chloroacetanilide N-alkylformylase, ferredoxin reductase component (cndC1) from Sphingomonas wittichii (strain DC-6 / KACC 16600)

KEGG orthology group: K00529, ferredoxin--NAD+ reductase [EC: 1.18.1.3] (inferred from 100% identity to sme:SMc00914)

Predicted SEED Role

"Ferredoxin reductase" in subsystem Anaerobic respiratory reductases

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.18.1.3

Use Curated BLAST to search for 1.18.1.3

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q92RR4 at UniProt or InterPro

Protein Sequence (405 amino acids)

>SMc00914 oxidoreductase (Sinorhizobium meliloti 1021)
MSGRLVVVGGGQAAFALVAKLRALKDMRPITVVAAEASLPYQRPPLSKKYLLREMTLDRL
LYRPEAWYAEHEIDIRLSTTVTRVDRLAKQVALSDGSMLTYETLAFATGATPRRLPAAVG
GDLAGVFVVRDFRDADRLAEEMQPGRRVLVVGGGYIGLEAAAVARTSGLEVTVIEMADRI
LQRVASAATSAIVREIHRSHGVDIRERTGLHRLIGDNGRVTAAELSDGSVIPVDIVIVGI
GVAANDALAHEAGIETANGIVVDSHGRTSDPTIVAMGDCAVLPWDGMRIRLESVQNAVDQ
AEAVAAVLAGGTDPYDPKPWFWSDQYDVKLQIAGFGLGHDETLVRQGQRQGSVSVWYFRQ
GKLIAVDAINDAKAYVTGKKLLEAGATPDRLLLADPQVDLKALLV