Protein Info for SMc00876 in Sinorhizobium meliloti 1021

Annotation: ATP-binding MRP protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 384 PF01883: FeS_assembly_P" amino acids 6 to 75 (70 residues), 52 bits, see alignment E=2.4e-17 PF10609: ParA" amino acids 121 to 363 (243 residues), 339.7 bits, see alignment E=3.5e-105 PF13614: AAA_31" amino acids 123 to 161 (39 residues), 37.6 bits, see alignment 8e-13 PF09140: MipZ" amino acids 124 to 251 (128 residues), 39 bits, see alignment E=2.1e-13 PF01656: CbiA" amino acids 125 to 340 (216 residues), 50.6 bits, see alignment E=6.4e-17

Best Hits

KEGG orthology group: K03593, ATP-binding protein involved in chromosome partitioning (inferred from 100% identity to sme:SMc00876)

Predicted SEED Role

"Scaffold protein for [4Fe-4S] cluster assembly ApbC, MRP-like"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q92RN2 at UniProt or InterPro

Protein Sequence (384 amino acids)

>SMc00876 ATP-binding MRP protein (Sinorhizobium meliloti 1021)
MPDVTREMVLEKLRTVRGPDMEGNIVDLGLVSDVFISDGKAYFSITVPADRAKELEPMRA
AAERVVREIPGVNAAMVALTADRKAAPQKAPVERPRPAPTGHAPAQRAGGGGAPKAGIPG
VGAIIAVASGKGGVGKSTTSVNLALALQANGLKVGLLDADIYGPSMPRLLKISGRPQQIE
GRLIRPMENYGLKVMSMGFLVDEEVAMIWRGPMIQSALLQMLREVAWGELDVLVVDMPPG
TGDAQLTMAQQVPLAGAVIVSTPQDLALVDARKGLAMFRKVEVPVLGIVENMSYFVAPDT
GRRYDIFGHGGARKEAERIGVPFLGEVPLTMGIRETSDAGTPLVASEPDGEVARVYRDIA
ARVWGEVTAARQDKSRAMPSIVFE