Protein Info for SMc00852 in Sinorhizobium meliloti 1021

Annotation: transmembrane signal peptide protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 644 signal peptide" amino acids 1 to 24 (24 residues), see Phobius details transmembrane" amino acids 231 to 253 (23 residues), see Phobius details amino acids 386 to 407 (22 residues), see Phobius details amino acids 413 to 435 (23 residues), see Phobius details amino acids 448 to 476 (29 residues), see Phobius details amino acids 482 to 502 (21 residues), see Phobius details PF09972: DUF2207" amino acids 27 to 214 (188 residues), 137.9 bits, see alignment E=4.2e-44 PF20990: DUF2207_C" amino acids 273 to 442 (170 residues), 73.2 bits, see alignment E=2.9e-24 amino acids 453 to 564 (112 residues), 83.9 bits, see alignment E=1.6e-27

Best Hits

KEGG orthology group: None (inferred from 98% identity to smk:Sinme_0561)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q92KK6 at UniProt or InterPro

Protein Sequence (644 amino acids)

>SMc00852 transmembrane signal peptide protein (Sinorhizobium meliloti 1021)
MRRLFAALALVTFVLAAPRVAAAEEFISAYHSVIELAKDGTLTVTETITANVEGNRIRRG
IYRDFPLTFADERNGRSKVDFNLLSVERDGDEEEYRTESISGGIRIYTGSADVLLPHGEH
TFQITYETSRQIRFFDDHDELYWNVTGTEWAFPIEEATATVTLPEGVKAEALDVFTGGYG
ATEKDARAVEEGDEIFFATTRRLRPQEGLTVAIKLPKGSIERPTSSQENIWWLRDHMTVV
IAGSGLLLVLLYYGRAWVRVGRDPARGVMVPRWDPPDGVSPALVNYIDNKGFSGEGWTAL
SAAALNLAVKGHVILEDLKNAVVITATGKNGEKLPTGEAALMKAVDAAGGKLTIDRANGK
KIQAAGSGFRSAMEREHRGKYYRANTGYVVGGIVLSVATLAALFVFGDLSEDSVPFVIVP
VFLAVFISAFAVSVGKSLRRGSSLARRILSIVVLAFVGFVLFTVFSSILAALVFSASDPG
DLPLFFAIGGIVLVNGLFYYLMGAPTPLGTRMMDGIDGLRQYLTLAEKDRLNMQGAPEMS
PRHFETLLPYAVALGVEKPWSETFERWLLAASAGAAAAAYQPSWYHGDSFGPGSFTDTIG
GFAGSMADTMTSSLPPPPKSSSSGFSSGGGFSGGGGGGGGGGGW