Protein Info for SMc00850 in Sinorhizobium meliloti 1021
Annotation: hypothetical protein
These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.
Protein Families and Features
Best Hits
Swiss-Prot: 43% identical to YBBK_BACSU: Uncharacterized protein YbbK (ybbK) from Bacillus subtilis (strain 168)
KEGG orthology group: None (inferred from 100% identity to smk:Sinme_0563)Predicted SEED Role
"Purine nucleoside phosphorylase (EC 2.4.2.1)" in subsystem Adenosyl nucleosidases or Deoxyribose and Deoxynucleoside Catabolism or Purine conversions (EC 2.4.2.1)
MetaCyc Pathways
- purine nucleotides degradation II (aerobic) (11/11 steps found)
- superpathway of purine nucleotide salvage (13/14 steps found)
- purine ribonucleosides degradation (6/6 steps found)
- adenosine nucleotides degradation II (5/5 steps found)
- adenine and adenosine salvage III (4/4 steps found)
- guanosine nucleotides degradation III (4/4 steps found)
- inosine 5'-phosphate degradation (4/4 steps found)
- purine deoxyribonucleosides degradation I (4/4 steps found)
- superpathway of purine deoxyribonucleosides degradation (6/7 steps found)
- ureide biosynthesis (6/7 steps found)
- purine deoxyribonucleosides degradation II (3/3 steps found)
- pyrimidine deoxyribonucleosides degradation (3/3 steps found)
- superpathway of pyrimidine deoxyribonucleosides degradation (5/6 steps found)
- adenine and adenosine salvage I (2/2 steps found)
- guanine and guanosine salvage I (2/2 steps found)
- xanthine and xanthosine salvage (2/2 steps found)
- adenine and adenosine salvage V (2/3 steps found)
- superpathway of guanine and guanosine salvage (2/3 steps found)
- nucleoside and nucleotide degradation (halobacteria) (2/6 steps found)
- nucleoside and nucleotide degradation (archaea) (4/10 steps found)
- fluoroacetate and fluorothreonine biosynthesis (1/6 steps found)
- arsenic detoxification (mammals) (8/17 steps found)
- salinosporamide A biosynthesis (4/15 steps found)
KEGG Metabolic Maps
- Biosynthesis of alkaloids derived from histidine and purine
- Nicotinate and nicotinamide metabolism
- Purine metabolism
- Pyrimidine metabolism
Isozymes
Compare fitness of predicted isozymes for: 2.4.2.1
Use Curated BLAST to search for 2.4.2.1
Sequence Analysis Tools
PaperBLAST (search for papers about homologs of this protein)
Search CDD (the Conserved Domains Database, which includes COG and superfam)
Predict protein localization: PSORTb (Gram-negative bacteria)
Predict transmembrane helices and signal peptides: Phobius
Check the current SEED with FIGfam search
Find homologs in fast.genomics or the ENIGMA genome browser
See Q92RL1 at UniProt or InterPro
Protein Sequence (172 amino acids)
>SMc00850 hypothetical protein (Sinorhizobium meliloti 1021) MTARILVSACLMGHAVRYDGASKPLIHPAVDRWRREGRLVTICPEMSAGMPVPRPPAEIE GGRTGADVLAGRSRVLEKTGGDVTSEFRRAAENALALARETNCRFALLIDGSPSCGSGFI YDGRFSGERIAGEGVTAALLRANGVEVYSDREIETLVARIGGDTGNGVGGWQ